CAZyme Information: PUG3_T010062-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T010062-RA-p1
• CAZy Family: PL3
• CAZyme Description: Beta-glucan synthesis-associated protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427	PultBR650_SC1144|CGC1	46670.06	6.6444

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC1144:4615-6200(-)

Full Sequence      

MWPWSYNECNEELAPMQRISADCKTPGANFPGIPTAVYNARGHKSWYQGLKYTPNTLCTP
VSSQIQDPTAVIAIAKKGFTDNTCSTGVNRLDNTTRYWGVNDKGGCMPVINGYQGSYLCD
PDNSNKKCADPLTAATSKSNVMSSFNYQMDAISANSGLPLAAYTDYLRYQVEWVTGSQGY
VRWLVEGIPIFEIPAESMENPPQDSKNSNPKKVMIEEPMYIIFNVALSTSWGSKPPNPGK
PCKGDGKNAATNKICDEFPMYMKIDYIRLYQDTSKGSNMTIGCDPATHPTKKWIEGHIEE
YQDAKNLIVDVVGGAPCKTDDDCTVSTCKRGVCSCLSSGAWGGPRCTLAVSDTAAAKGFG
PSIELASIFAAIAVALFLFVMYKIVIARRNKKMLESMTVPKSAARFDVEIDDVAQSRSAP
NPDDKLI

Enzyme Prediction     

No EC number prediction in PUG3_T010062-RA-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	3.93e-18	146	307	342	481	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	5.84e-16	147	271	188	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185693	GH16_laminarinase_like	2.04e-11	162	270	156	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185683	Glyco_hydrolase_16	3.95e-05	158	270	136	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA25842.1|GH16_2	9.60e-152	1	384	211	675
CCA24749.1|GH16	8.52e-130	18	374	156	538
UIZ27810.1|GH16	2.19e-128	22	381	343	730
UIZ28149.1|GH16	1.61e-127	22	365	304	682
UIZ28151.1|GH16	1.78e-126	23	352	308	665

PDB Hits     

PUG3_T010062-RA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13941|YEPB_SCHPO	3.87e-10	176	313	501	615	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1
sp|P32486|KRE6_YEAST	5.52e-10	168	304	578	690	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|P33336|SKN1_YEAST	1.00e-09	168	304	630	742	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|P87024|SKN1_CANAX	2.15e-08	165	302	602	715	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1
sp|P87023|KRE6_CANAX	4.98e-08	165	304	605	720	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000003

TMHMM  Annotations     

Start	End
365	387