CAZyme Information: PUG3_T009506-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T009506-RA-p1
• CAZy Family: GH5
• CAZyme Description: Glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408	PultBR650_SC1001|CGC1	46793.20	6.8081

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC1001:8938-10435(-)

Full Sequence      

MNEPSSGYIGVKDLSKCFQPGELKYDFAPTPFQGMCLGEAIPQVVGRWSNGFMQHDEGVW
DIDAQGHAKLLRPDYFAHVDFGRDCYVPFAAKFAERIYRILPQTLLFVELPPLEFSSTEF
PQIDEHVIPRAVNATHWYDGVTLFLQTWRPWFSVDPKTKMPAFGCAAVRRMHERQLRHIK
DYGRLHMNNAPCLIGETGIPYNLNNAKAYRTGDFSAQRDALDHTISCLEANLLSFTLWCY
EASNCNKYGDQWNLEDLSLVSLDRQQPKVRDSDDVLAFARPHATKIAGIPSKSIFRLNRA
KYVLEYASDVGKLSEHIMAPTEIFVPHVQYPHGYDINVSDGKYDVQEHDGWDTIVYHHDE
KHTHHTLMLTTKDPNVARRYKAQERRQQLMVGVTGISLVVILVFLFTR

Enzyme Prediction     

No EC number prediction in PUG3_T009506-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	56	245	1.3e-53	0.3821892393320965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408348	Glyco_hydro_5_C	2.07e-22	280	365	1	83	Glycoside hydrolase family 5 C-terminal domain. This is the C-terminal domain of endo-glycoceramidase II (EGC), a membrane-associated family 5 glycosidase pfam00150. The C-terminal domain assumes a beta-sandwich fold, which resembles that of many carbohydrate-binding modules.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27469.1|GH5_12	6.53e-166	1	392	253	695
CCA13966.1|GH5_12	1.33e-123	1	405	299	769
AIG56220.1|GH5_12	3.65e-115	1	370	265	658
BAJ64239.1|GH5_12	5.44e-67	1	345	234	600
QRN82755.1|GH5_12	6.25e-62	1	346	233	600

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LPO_A	4.25e-34	1	330	269	716	Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1BTD7|EGCR1_RHIO9	2.41e-44	1	330	252	628	Glucosylceramidase OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) OX=246409 GN=ERC1 PE=1 SV=1
sp|H1AE13|EGCR1_ASPFM	2.46e-34	1	263	245	565	Glucosylceramidase OS=Neosartorya fumigata OX=746128 GN=egc1 PE=1 SV=1
sp|H1AE12|EGCR1_CRYNH	1.50e-30	1	326	256	635	Glucosylceramidase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=EGC1 PE=1 SV=1
sp|P40566|EGH1_YEAST	3.09e-29	1	263	263	582	Ergosteryl-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

Start	End
389	406