CAZyme Information: PUG3_T008466-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T008466-RA-p1
• CAZy Family: GH5
• CAZyme Description: UDP-glucose:glycoprotein glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1648		185988.89	5.4534

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC0778:1362-6405(-)

Full Sequence      

MRMPLWTAAAAAASVAFLQQQVQARGVSVNLTASWPSSPHFPLLETSEFLAEENPAFFWQ
YIDLLQPQTTAIADKSRDVDALAEFAVQNALTVAPASQNVSGQIEKCICYRFCLMIALIL
YMFELVAVQILELMLATRTYSVKVEMHRQLGLDSRLRPCGADAETWAVFYSEKQCVEAVA
CTASELDAVFAGEKTAEQTCVAAGVNDVEQTIDHKYPQSLSVGKTAILYGLMGMPDFYDF
HNVLKARAESNEVQYILRHFAKNSTLETLLQGYGVALDIKNMEYKTIDDSKKNDGDDDVV
DTVDDDEDGDSEDGEEEDVEGFLFNVLVQRHGAIATELKEFRDSLVKQDDQAQEVKAWHL
KDLGLAAARDILDAKHPLKRLQALSQDFPKHAKKLAFSRKPLTDEFRAEIERRQTEAVQN
GLVNKFLLNGISIDPTQRSFNIYDFMSTLKEEWSVAKKLVALPLNDSELNTMLAHVRESN
QAQKAVRIRVRGTYEGTAPFYLNNIETDSKTAQWPLDIDQLRRPAWNIIFVRKNMYEYVV
VFDPMTSNGRTTLNQIAFMRMRGAPLQWGLLISSKELMEAKVGKERDALIQRWKFFKVDD
RANAWHFSKLLFLARAKDAEVAAKEEDPRKQSSNRIVSAFIEGVADEGTTEVTIQHLVTS
YVDSAFGLMSRAKLEEEALYVLRSDENNDLVLSMTEYIQKKHLPLESSLFNGVLRKNTDV
QSEIMNHLGRDQGVYQAMARNDQLEQDTDFIEELLSTQETYPAYFPIFDTSKNAEDGSKS
PQNLLSHDADHKIENLLEAHVDHFHASDSLLIPKKQTLLFVANLGYQAHAGHVYRGVKAV
LEDSEKALRVGVVPRLDATDGQETSAFVASIIAAVGTSDEESHLRFVMEALNCVMKGKSL
ESSKTKLTGILNKLEKEDGFKDKKMLSTLKNIVSGGENLLSDAKKAGFKQLSSLLMGAST
RDQLARLYINGFPIDLPAHSISDEDMAALTEFDSKYRSHAVGKAFVKKSAKLTMDEANKV
SLDIVKVCDLVDKYKKAERAGSLDLEDSQLVVRLPGDPALTVSAYLDPLSEASQMISSLL
LMLHTQLNATIELVLLPSADYAQFPLQRFYRYLFGKTPSLATPSVEFRKLPIKPILTMKI
ETPEAWNVQIHETKEDLDNLRVDPDSAVDVKATKTAVFKLESLLVYGQCRDKTFEMYTPP
HGLQLVLERDVGTQRLHRDTLVMRNFGYFQLQATPGVWSLHLARGRATELFEIVDMASDQ
AVDATPVQVYDFGSRLSQLIVRKRKGREHDVLLDPEAIKKASKRDVEPIAEDAGILGSYW
GSMMSLLGKKSTKETVEVNASNVDESAIVAHSNVNKGRIGETIHVFSLATGHLYERFLKI
MMSSVLKRTKNPVTFWLLENFLSPDFKQSIPALRETFGMDIRLVTYKWPNWLRQQTQKQR
VIWGYKILFLDVLFPLGVQKIIYVDADQVVRADLKELWEMDLQGAPYGYTPFCDSRNVGF
QFWRQGYWKDHLRGRPYHISALYVVDLALFRQMAAGDALRATYEQLSADPNSLSNLDQDL
PNYMQHQIKIFSLPQEWLWCDSWCSDESKAQAKTIDLCNNPKHKEPKLDMAKRVISGELF
NESWIELDQEIKDAEAKFFKDSAAAPSE

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1363	1608	3.2e-124	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1363	1633	1	267	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	2.62e-162	1363	1608	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	2.76e-60	1363	1603	1	243	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408199	Thioredoxin_12	1.07e-31	43	264	5	181	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408200	Thioredoxin_13	4.54e-23	355	475	9	124	Thioredoxin-like domain. This is the second out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20865.1|GT24	0.0	1	1644	1	1666
CCA14500.1|GT24	0.0	15	1638	27	1665
AIG55512.1|GT24	0.0	25	1638	24	1515
AIG56125.1|GT24	0.0	15	1639	16	1506
BAD28382.1|GT24	6.90e-201	10	1646	26	1604

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TRT_A	3.38e-134	216	1633	152	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5MU1_A	6.31e-134	216	1633	152	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	1.32e-133	1064	1633	660	1212	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	2.20e-133	216	1633	152	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5H18_A	2.74e-113	1363	1633	5	271	Crystal structure of catalytic domain of UGGT (UDP-glucose-bound form) from Thermomyces dupontii [Thermomyces dupontii],5Y7F_A Crystal structure of catalytic domain of UGGT (UDP-bound form) from Thermomyces dupontii [Thermomyces dupontii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09332|UGGG_DROME	3.32e-192	23	1632	26	1505	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q0WL80|UGGG_ARATH	2.52e-189	20	1637	26	1571	UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1
sp|Q6P5E4|UGGG1_MOUSE	1.30e-185	17	1638	37	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	1.30e-185	17	1638	37	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	1.40e-184	17	1641	37	1530	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000319	0.999697	CS pos: 24-25. Pr: 0.9722

TMHMM  Annotations     

Start	End
108	130