CAZyme Information: PUG3_T008443-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T008443-RA-p1
• CAZy Family: PL1
• CAZyme Description: Cellulose synthase 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1068		119331.35	5.8761

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC0773:972-4381(-)

Full Sequence      

MYVVLVGFVAAYTAIATLSSDTNEWIALGAAAGAGVLAGAVIGFVTMLGPLLLILVTGAI
VGPYLLLIDAHDGVGLFPADNQLARQEFVVAFLIIFVLVCSSRSKTNEMENHRFNFQHGG
SAALRDIDSSAQTLMFLVWGGVAIVGVLNQMAMRWGLACYNRVGSHAQLSGGAIEETLPE
LPSGATLVAQLPTERVRLVCENCFATVPSGTAFCTECGEAMPGDDVDPNVSISQAQMPSV
AMNSTTNVPDRWQPIPNRAYVSTTSYVDPKMARGDPSMKGDNGRSIRFMDAGVQDPDGKM
RGYNDNSMANRPNFYEPSFRSFAMSTYSIANRAAEPVETPNIRKYKMSGSGIFHLVYFLS
AIAGIWWLAFLVGYYPQEYFCSHVAPTLPCSKLDDSVKTGCYSSTKNFDASTDEGYCIRD
TPVAVWLMYGMMVFSEFLNFFLGLLFNFSMWRPIRRGARYMNDFKPPIPKEQWPTVDVFL
CHYTEPVSDTMQTLKNCLAMQYPPELLHIWILDDGYTKSVWDANNHFKVTVNTKVIEQCG
DLRGDLARLMHERIVGPVQDDTSLKSWRRQHSSVRELRKEGGKGVQRRDCAVGSLSDDYD
YRDRGIPRVTFVGRMKPETHHSKAGNINNVLFNEGAEGKYILILDNDMKPHPKFLLAVLP
FFFSEGEAVDGGGRQYSDDISWNQVSYVQTPQYFEDTPQLTIMGDPCGHKNTIFFDAVQC
GRDGFDSAAFAGTNAVFRRQAFDSIGGIQYGTQTEDAYTGNILHTSGWDSVYFRKDFEGE
PKDRIRLCEGAIPETVATSMGQKKRWAKGAVQILLMKNESEVDPDWRPPRVPAPDPKPSL
AFPRKMFFWDSVFYPFGSIPAMCYVIIAIYYLCTGDAPIYAKGTMFMYSFLPTMLIKWLL
NLLANRAVDNNDVWRAQQTWFSYSFVTMLAIIEAIQARVTGKDKSWANTGAGQKTSWTEI
PNVLIFFTMGVSQIVALIRFFQYENATNPWNYVSAMFFGLFIMSNFYPMVKMSITEYCGW
DHTSATFTANIFGSLIMVFMVVFVQLWQVYYTDNLAVAQGQTDTSSST

Enzyme Prediction     

EC	2.4.1.12:3

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	8.43e-52	474	814	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
236918	bcsA	2.04e-30	465	818	248	496	cellulose synthase catalytic subunit; Provisional
224136	BcsA	4.74e-19	616	946	118	419	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133057	CESA_NdvC_like	3.15e-18	623	816	70	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
215121	PLN02189	6.99e-14	451	1011	305	990	cellulose synthase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFB20360.1|GT2	0.0	7	1068	48	1140
AFB20358.1|GT2	0.0	7	1068	48	1139
AFB20359.1|GT2	0.0	7	1067	47	1136
AEZ51039.1|GT2	0.0	7	1062	49	1132
AIK98134.1|GT2	0.0	7	1062	49	1135

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	2.54e-27	461	901	258	577	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	7.94e-25	462	945	116	499	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	9.40e-25	462	945	128	511	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	9.42e-25	462	945	129	512	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7D5K_A	2.69e-10	423	1011	280	992	Chain A, Cellulose synthase [Gossypium hirsutum],7D5K_B Chain B, Cellulose synthase [Gossypium hirsutum],7D5K_C Chain C, Cellulose synthase [Gossypium hirsutum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9U720|DCSA_DICDI	1.62e-40	589	1041	564	1045	Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum OX=44689 GN=dcsA PE=1 SV=1
sp|Q93IN2|BCSA_SALTY	2.44e-27	461	901	258	577	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
sp|Q8Z291|BCSA_SALTI	4.24e-27	461	901	258	577	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
sp|P37653|BCSA_ECOLI	1.27e-26	461	901	258	577	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
sp|Q8X5L7|BCSA_ECO57	1.68e-26	461	901	258	577	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996779	0.003224

TMHMM  Annotations     

Start	End
2	20
25	44
51	68
83	102
353	375
424	446
852	874
884	903
920	939
959	981
988	1010
1025	1047