CAZyme Information: PUG3_T008196-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T008196-RA-p1
• CAZy Family: GH5
• CAZyme Description: Mannosyl-oligosaccharide alpha-1,2-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394		45639.33	6.6954

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC0729:811-2214(+)

Full Sequence      

MDTLWIMGLKDEFARAREYVAKSLRFDHLGKDHKKISVFETIIREVGGLLSAFSLSQDDV
FKDKAKELMDLLTPAFNEKEGVFYTLFNPYTKERTFASWAGYKAHIADIGTLQLETRYLS
DITGDPKYAKMGDAFYEILQREGSYLNTGLFPVHFDAHNGKFHTRSSVTFGALGDSFYEY
LIKVYIYSGKRDKDAYLRKLYDDAVDGLEKHLLVYSKEDDLYYLQELTLPSMSGVHRMDH
LLCFVPGMLALGTLAETKDTAKNARHLDIATKLMETCYQIFPHMLVRDGKYRLRPEAIES
LFYLYRITKDVKYREYGWQIFEAIETHAKLKFGYGAIKDVTELPARKDNKMESFFLAETL
KYLYLLQAPDDLIPLDEYVFNTEAHPIRIRKGNA

Enzyme Prediction     

No EC number prediction in PUG3_T008196-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	1	389	1.9e-113	0.905829596412556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.38e-162	2	389	42	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.90e-145	1	393	118	522	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22976.1|GH47	1.18e-196	1	393	185	605
CCD28123.1|GH47	8.46e-143	82	393	3	330
AIG55877.1|GH47	5.93e-140	1	343	125	489
VDC71931.1|GH47	8.22e-95	1	393	151	547
CAG7876837.1|GH47	8.22e-95	1	393	151	547

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KKB_A	3.05e-80	1	389	72	467	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	3.87e-80	1	389	70	465	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
5KIJ_A	1.66e-78	1	389	51	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	1.96e-78	1	389	56	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	2.06e-78	1	389	56	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8H116|MNS2_ARATH	9.78e-95	1	393	145	541	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
sp|Q9C512|MNS1_ARATH	2.55e-88	1	393	144	540	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
sp|O18498|MA1A1_SPOFR	4.13e-85	1	393	248	648	Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
sp|P53624|MA1A1_DROME	1.40e-80	1	394	251	652	Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Drosophila melanogaster OX=7227 GN=alpha-Man-Ia PE=2 SV=2
sp|P45701|MA1A1_RABIT	4.83e-78	1	389	61	456	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=MAN1A1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PUG3_T008196-RA-p1.