CAZyme Information: PUG3_T007507-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T007507-RA-p1
• CAZy Family: GT71
• CAZyme Description: Methyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
973		109404.78	6.2079

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC0615:9709-13179(-)

Full Sequence      

MRVQQWRTWRHVWLLLLCIALASGMSSAAPTMPIATTSAPAFPCQTAAFGGYIHPGTTQY
RVAVAWGDAQLACEPFEEEGDERVYHNAIVVVQRGRCSFQEKWHNVAHAGGSGMLLVNSE
DTLLQLGGIAYDGSSDTMALSIAKPDAESLLESLHAHSQQRDDDTTYLSITLPMSRLEQV
AARIQYLLQTNMPLIAYEYFMDELAVSSSPMILRDFDALLATLTQHAERSMWIAKIDNIT
SWFVFFKLCALLFPSQYEFASTAGLHASVAAVSLLLQAPHVTKGNKHNELWTHAAKKLVD
AGYYNQSAFCLSQIAEEQLSEYECQLAFIQFVQGNLIESIPISRGCVDNGFGPNLSVSEG
LHVAHETLLRVAGMKMSSDDLRCLHQAATGKLSDEDGLNVSNESLQCCWRHRPVPSISKS
HDESQALQQRRARHGNLFLSPFVKELFEALNVMGVFLDELGAFNESLIFFQQAAQLCPYD
VTLQLRQVLAVPVVFASNDEITRFYSQLKSNIHTLMVEDQRTCVAEEGAFNIRPEHAAYL
QYTITPPTMFIGYQPYEMVYRLQGIDVLPVQRAIHALRTTVYPSLQPQPAAWETDSLPPS
QEATGRRRIAFVSTWFRNHSVGKLLLGVIEHLDRTKFHIEIYRCVHFLRLPDEITDAFRR
VADTYTELPVDMDDALALLRREHIDVLIYPELGMDEWTLLLAHHRIAPVQCVFWGHPITT
GNPAIDYFISSEYFVSDFFDSDGNPGNDKNDSIDKKDSADMFMHHGTHFSEQVVLFRGLG
TFFTQPKLSSHNAEPKITRTMLQLPANGRLYTLMKLHPSFDDVLLGILKRDLHGYIVLLM
SSTQQVWKEQLRARWRRHHAGSTRRILFLNTLPYAEFLALLSFSDVVLDPFPPVVTLPSA
QTVVQLAAGFLRYMNVADTIVASVAQYVRLATDIANNTNGVRTKLHAVLLANHHNIYDDA
ASVNDWNAFLAQV

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	1.30e-28	598	937	250	577	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
240122	PA_subtilisin_1	1.04e-06	45	158	1	112	PA_subtilisin_1: Protease-associated domain containing subtilisin-like proteases, subgroup 1. A subgroup of PA domain-containing subtilisin-like proteases. The significance of the PA domain to many of the proteins in which it is inserted is undetermined. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Proteins into which the PA domain is inserted include the following subtilisin-like proteases: i) melon cucumisin, ii) Arabidopsis thaliana Ara12, iii) Alnus glutinosa ag12, iv) members of the tomato P69 family, and v) tomato LeSBT2. However, these proteins belong to other subtilisin-like subgroups. Relatively little is known about proteins in this subgroup.
238300	PA	3.23e-05	68	159	28	121	PA: Protease-associated (PA) domain. The PA domain is an insert domain in a diverse fraction of proteases. The significance of the PA domain to many of the proteins in which it is inserted is undetermined. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Proteins into which the PA domain is inserted include the following: i) various signal peptide peptidases including, hSPPL2a and 2b which catalyze the intramembrane proteolysis of tumor necrosis factor alpha, ii) various proteins containing a C3H2C3 RING finger including, Arabidopsis ReMembR-H2 protein and various E3 ubiquitin ligases such as human GRAIL (gene related to anergy in lymphocytes), iii) EDEM3 (ER-degradation-enhancing mannosidase-like 3 protein), iv) various plant vacuolar sorting receptors such as Pisum sativum BP-80, v) glutamate carboxypeptidase II (GCPII), vi) yeast aminopeptidase Y, vii) Vibrio metschnikovii VapT, a sodium dodecyl sulfate (SDS) resistant extracellular alkaline serine protease, viii) lactocepin (a cell envelope-associated protease from Lactobacillus paracasei subsp. paracasei NCDO 151), ix) various subtilisin-like proteases such as melon Cucumisin, and x) human TfR (transferrin receptor) 1 and 2.
239039	PA_PoS1_like	9.58e-05	72	156	43	121	PA_PoS1_like: Protease-associated (PA) domain PoS1-like. This group includes various PA domain-containing proteins similar to Pleurotus ostreatus (Po)S1. PoSl, the main extracellular protease in P. ostreatus is a subtilisin-like serine protease belonging to the peptidase S8 family. Ca2+ and Mn2+ both stimulate the protease activity of (Po)S1. Ca2+ protects PoS1 from autolysis. PoS1 is a monomeric glycoprotein, which may play a role in the regulation of laccases in lignin formation. (Po)S1 participates in the degradation of POXA1b, and in the activation of POXA3, (POXA1b and POXA3 are laccase isoenzymes), but its effect may be indirect. The significance of the PA domain to PoS1 has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.
240120	PA_SaNapH_like	2.01e-04	88	122	45	79	PA_SaNapH_like: Protease-associated domain containing proteins like Streptomyces anulatus N-acetylpuromycin N-acetylhydrolase (SaNapH).This group contains various PA domain-containing proteins similar SaNapH. Proteins in this group belong to the peptidase M28 family. NapH is a terminal enzyme in the puromycin biosynthetic pathway; NapH hydrolyzes N-acetylpuromycin to the active antibiotic. The significance of the PA domain to these proteins has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55953.1|GT41	2.60e-127	43	973	42	874
QDU81044.1|GT41	3.22e-55	606	973	672	1023
QDU00599.1|GT41	3.69e-51	411	969	406	917
QDT82656.1|GT41	2.01e-50	544	969	525	917
QDT18528.1|GT41	2.66e-50	544	969	525	917

PDB Hits     

PUG3_T007507-RA-p1 has no PDB hit.

Swiss-Prot Hits     

PUG3_T007507-RA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.026620	0.973342	CS pos: 28-29. Pr: 0.9192

TMHMM  Annotations     

Start	End
12	34