CAZyme Information: PUG3_T007359-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T007359-RA-p1
• CAZy Family: GH37
• CAZyme Description: Lysosomal beta glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
741	PultBR650_SC0595|CGC1	80348.33	5.5675

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC0595:5053-7408(+)

Full Sequence      

MLRSWLGAVCCCVVLACNSVAAVAAADAWDSKADAIMSKFTLDDILGQMTQINIDNILNA
DLTLNEDRVREYAKLRIGSYLNSPYSGGPKDGKYGWTAQEWRKLITRIQEISMAENGGHP
IVYGIDSVHGAVYVSNSTLFGQQINGGASFNPDLVYEMGRVTGRDTEAAGIPWVFGPILE
ISQNPLWARTFETFGEDPYLVSVMADSVIRGLQSNSATAACMKHFVGYSKTPTGHDRDGV
SIPKILRDLIRSDMGFEGVVVTDWAEINNLQDWHRVARSKPEAVRMALTQTSLDMSMVPY
ETTFIDHAKTMLQSNPEYLDRLKESARRVVKMKLKLGLYDNPVPGAANVDLVGNEKDIAS
ALELARESITLLKNQDNVLPIAPTSSVFLTGHSADNVGYLCGGWTIAWQGQSGNAMFPHG
ISVKQGFEKIGNSSVTYFNGLSADGSYTAADMATAKAQARVSEYTVAVIGESTYAEKPGD
INDLALPAGQIAYVRELASTGTKVIVVLVGGRPRLLNGLAGSVHAVINAFLPCEQGGQAI
AEIIYGKVNPSGRMPITYPKDAANIMIPYNHRVSTQCSSGYCQMEWDFGAGLSYTTFTYS
SVKLSKTTVTGKSDSITASVTVTNSGKMTGKETVMLFVIQPYRSISVPEVKQLKKFKKIS
LDAGASATVEFTLTAADWSVYDPQIGNGFVQVAEDGDFVVAVKPETECNVYGTITNPLCA
KFELKTGVEPFNLEESLKTRY

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	115	237	1.9e-37	0.5509259259259259

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.83e-96	5	702	3	750	beta-glucosidase BglX.
224389	BglX	1.16e-50	41	406	2	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	3.98e-46	369	594	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	4.28e-40	41	329	1	313	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	9.14e-39	134	673	108	742	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	8.03e-312	1	724	1	762
CCA27737.1|GH3	1.86e-289	31	724	66	808
UIZ27116.1|GH3	7.16e-288	49	725	1	725
UIZ29613.1|GH3	8.70e-274	1	730	46	825
UIZ29432.1|GH3	3.85e-271	1	730	1	769

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	2.34e-121	37	700	21	737	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5M6G_A	6.79e-68	32	558	50	587	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
7EAP_A	6.28e-65	30	707	15	746	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5YOT_A	6.28e-65	30	707	15	746	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
5XXL_A	2.86e-64	30	702	11	737	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	4.54e-137	30	702	77	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	1.72e-120	37	700	43	759	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|T2KMH0|PLH24_FORAG	1.37e-66	103	715	49	719	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|P33363|BGLX_ECOLI	1.84e-65	27	702	32	750	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|Q56078|BGLX_SALTY	6.58e-65	27	702	32	750	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.003990	0.995998	CS pos: 16-17. Pr: 0.4343

TMHMM  Annotations     

Start	End
7	29