CAZyme Information: PUG3_T007053-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T007053-RA-p1
• CAZy Family: GH31|GH31
• CAZyme Description: CBEL protein, formerly GP34

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
695		74555.56	5.2072

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC0547:1049-3410(-)

Full Sequence      

MKSFTRVAFAALGATGACLLTGTQAFIQAVLERPPNNMAVTYSPMHSMAYPFGNEAFNAT
KLGESIDEDFAIIATHFDKVRTYYSQYYGISVAKYAAAHNVKLHLGVFMTKESWLQGEID
NAIAAVRNYPETVEAILVGNENLHVDANATDILAIVAQIKSALGDQAAAVKFGTSQRVTE
YLDPQFDAQIGNLSAALDILGVNIYPFFDSGYNPAAPVAILDGAWNAVVAKYPVSKIVLT
ETGFPTSGAPSTLSPNNIPSLNNSIAYYNAVAQWTPDDGKASPKFWFDMFDRRPDDNTMQ
VELEKHFGLYTYDRQRKSLQYPTDLKGSLVSVQPASNSTSNSTSEPTSEPPLKPTPTPTP
QPTPIPEPTTAALTPEHTTTSPTPQPTSAPTPTPTLASAPTPNSTPTATPSPTPSVPCAA
NGAHCGNIADGAQCCESGAYCQPWDPWYYQCHSSPAKCGTQEVGVDYYGDDIRTVYGVLP
ETVGCVAYTFVNYNPDGQSACYLKKGFGEKRAVAGAVSGKPWDPNWYQCRPTPSQCGAQE
VGVDYYGNDISTVYGILPSECCDQCAATSGCVAYTFVNYNWDGVSACYLKHGVTETRTLV
GAVSSQVIKPKKECSCVATPRKCSQQFTDVDFYGYDMGVVYNTSPTRCCAKCSAMLGCKG
YTFVNENADGRPACYLKHSLAGKRASTGAVSGIVN

Enzyme Prediction     

No EC number prediction in PUG3_T007053-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	76	317	1.2e-21	0.9003215434083601

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238533	APPLE_Factor_XI_like	2.33e-14	620	694	2	72	Subfamily of PAN/APPLE-like domains; present in plasma prekallikrein/coagulation factor XI, microneme antigen proteins, and a few prokaryotic proteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions.
227625	Scw11	6.09e-14	1	314	5	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
128519	APPLE	1.57e-11	542	610	8	78	APPLE domain. Four-fold repeat in plasma kallikrein and coagulation factor XI. Factor XI apple 3 mediates binding to platelets. Factor XI apple 1 binds high-molecular-mass kininogen. Apple 4 in factor XI mediates dimer formation and binds to factor XIIa. Mutations in apple 4 cause factor XI deficiency, an inherited bleeding disorder.
238533	APPLE_Factor_XI_like	2.07e-11	533	604	2	69	Subfamily of PAN/APPLE-like domains; present in plasma prekallikrein/coagulation factor XI, microneme antigen proteins, and a few prokaryotic proteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions.
128519	APPLE	2.15e-10	623	692	1	73	APPLE domain. Four-fold repeat in plasma kallikrein and coagulation factor XI. Factor XI apple 3 mediates binding to platelets. Factor XI apple 1 binds high-molecular-mass kininogen. Apple 4 in factor XI mediates dimer formation and binds to factor XIIa. Mutations in apple 4 cause factor XI deficiency, an inherited bleeding disorder.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYE52146.1|CBM1	2.36e-94	420	695	1765	2110
QYE52130.1|CBM1	1.01e-86	421	695	229	532
AIG56157.1|GH17	8.28e-72	42	310	28	301
AIG55724.1|GH17	3.18e-71	29	325	14	319
CCA19272.1|CBM1	2.59e-68	425	692	28	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FCG_A	4.42e-07	118	327	146	390	Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_B Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_C Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_D Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_E Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_F Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P52407|E13B_HEVBR	4.78e-07	178	317	191	346	Glucan endo-1,3-beta-glucosidase, basic vacuolar isoform OS=Hevea brasiliensis OX=3981 GN=HGN1 PE=1 SV=2
sp|P52408|E13B_PRUPE	1.35e-06	100	317	86	344	Glucan endo-1,3-beta-glucosidase, basic isoform OS=Prunus persica OX=3760 GN=GNS1 PE=3 SV=1
sp|Q03467|E13B_PEA	3.39e-06	67	327	89	348	Glucan endo-1,3-beta-glucosidase OS=Pisum sativum OX=3888 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.024362	0.975618	CS pos: 17-18. Pr: 0.4443

TMHMM  Annotations     

Start	End
7	29