CAZyme Information: PUG3_T006706-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T006706-RA-p1
• CAZy Family: GH30
• CAZyme Description: Cell 5A endo-1,4-betaglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
748	PultBR650_SC0501|CGC1	83024.49	5.0148

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC0501:17122-20395(-)

Full Sequence      

MKLTAFEPDGGMPDERPRDYKGRYRNKRKIQDGLNNSADLIDDDGQVGNPKKYPDMGCEL
PNYLSKNGQIIAQSKNGTEVPVAIKGVNWFGMETGMRIPFGLWENSENGTSTYEISSFLA
RNKFNSVRLPVCIKSILDDIPPNKDLINMNTNRAMNVSTYMSTIKSIVKALAYRHALAYR
HISVLISLHTLDTTDSGGAWYSTALNVTQDQFLEAVDTLTSNLCTTDYWNILGLDLKNEP
HSCSWGGDAPDWVVGAALIGNRMLKGCKNWMAFVEGVNGDHTFTLNGTKSSYFDWWGSGL
QGVATLPITLSTEQKVVYAPHYYNTGVNPASYLYGGGTVGTESVLLNYVELDNATLKXXX
XKNWMAFVEGINKEHTFNMATVGNGTAKKNYFDWWGGGLQGVASDPVVLATEGKVVNKLN
VTEDQFLEAVDTLTSNLCSEEYWNILGLDLKNEPXXXXGAASALIDYVELDDETLKNNVE
ATFNDMFGYISKDKKDAVVLGEFAGLYGKDKHPKLTTKRTTDFTIQAMLDAGLAGGYMWS
LNPESAYQQQMENAVLDALFLDLLDDAPALWLDVPSPQSLSGEPGFFCNLNGVNASLKER
ASPEHVPAVCWGTENAPDLPQAVVEEKKPASVGSNGNTVRKRQRLQIQELRATALQFEKH
CHSHDEDEEDRCSLENRRKLKVAAAESSKQDRDAAEITALENIHLNKLVNDHSKVVEQFE
KVLRKQRPLSVGILHRQLWYYDCAISMG

Enzyme Prediction     

No EC number prediction in PUG3_T006706-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	79	359	3.5e-110	0.7994186046511628

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	4.53e-12	76	349	39	305	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	5.51e-05	85	323	6	195	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABL75350.1|GH5_20	5.18e-194	1	548	63	528
ABC87086.1|GH5_20	2.01e-193	1	548	62	527
ABC87087.1|GH5_20	1.45e-184	1	548	69	535
ABK59035.1|GH5_20	1.45e-184	1	548	69	535
ABC87088.1|GH5_20	1.33e-182	20	548	121	526

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VVG_A	2.38e-28	76	327	22	270	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3W6M_A	3.22e-28	76	327	22	270	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	7.54e-28	76	327	55	303	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	1.01e-27	76	327	55	303	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3QHM_A	1.01e-27	76	327	55	303	Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_B Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_C Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	9.33e-24	63	328	39	280	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	5.34e-22	63	332	46	290	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P10474|GUNB_CALSA	6.79e-21	81	374	644	945	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1
sp|P19487|GUNA_XANCP	1.78e-18	82	332	42	272	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PUG3_T006706-RA-p1.