CAZyme Information: PUG3_T006702-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T006702-RA-p1
• CAZy Family: GH30
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854	PultBR650_SC0501|CGC1	99405.01	7.6662

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC0501:3376-7277(+)

Full Sequence      

MVEIPVVKQSREDMWKKITSLKELDEYDCQAWRRTKKCNPRHPRTPAGDKSCTRQIQANE
AGFCEYKNRRTGELRVLMPATCKSRYSTLKYTCLDAKKMLRYNLMALDYTPEEPLSFATC
QRNLLEENGFQIANDNQAGAMDTESNNTIPASDLVRVVQDPIAAIQDNSVVVQDAKSAPP
SFSKGIVYVIYDKLLLSVYASIRSLRQLGCTLPIELWYSAKETNISHPILLEVTAKYGAY
LREIRDPRATKFYTKIYATFYSAFDQVLLLDADNFAVRDPSFLFQTQEFNNTGAIFWPDF
WRPNRTIFGLTSVSYVWELLGIKYVNMFEQESGQMHAKHSVLVELVNNYGVFLRVIEDPN
ATKFHAKPYTIYHSRFESVLFLDSDNIPVRDPTYLFDSPEFAKFGAMFWPDFWRAKKTIF
NIQPRSFVWDVFDLDFVDMFEQESGQVMIDRRRHLKAMNAMMYYAFHPQLVERLRLVWGD
KDLFRMAWLRTNSTGQVLVNKSMSAAAMNKLMFYSANVPRLLTDWELCKMRRLGQYICFL
MNPKTLSGDATPFLIKSLDGTKYPQVEKQAIHFSIEGRSLLSKTEEAEIAVLEEKELQKQ
AAETAAELARKEHDNQTWYTLMFGGCVLLLGEFQDTGAMFWPDFWKPGNTIFNIHEHSFV
WEFFGLDYVDMFEQESGQLLINRRKHLEALNVVMYYGFHLPRLHEELRLVWGDKDLFRFG
WMKTNSEFYMIPRPPGSAGTKHTDYDLFCGVTMVQHDPSGRVIFLHRNTEKLTHLNDRLL
WTHIQQYKRTSPLTEYFVRGANGGKVFPQFKRCFGKDVHYEKLFTLKPLSAFPFEHLEQS
LLQYSREGAALLNP

Enzyme Prediction     

EC	-	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	343	493	2.9e-33	0.6628787878787878
GT71	184	307	1.8e-31	0.5037878787878788
GT71	632	757	2.6e-24	0.5681818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	1.82e-28	183	492	1	237	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
402574	Mannosyl_trans3	2.42e-15	632	757	117	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	8.85e-05	192	299	10	126	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
133018	GT8_Glycogenin	0.009	362	421	80	129	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24059.1|GT71	3.47e-132	20	852	134	599
UIZ24000.1|GT71	3.63e-132	27	843	104	562
CCA25989.1|GT71	3.00e-88	7	843	79	534
UIZ27901.1|GT71	1.73e-84	25	617	68	546
CCA20051.1|GT71	4.78e-65	633	854	317	539

PDB Hits     

PUG3_T006702-RA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6ZQE9|MNN5_YEAS7	2.04e-11	181	302	147	276	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1
sp|P46982|MNN5_YEAST	2.04e-11	181	302	147	276	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|Q59KJ7|MNN21_CANAL	3.93e-11	176	346	236	425	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|Q5A687|MNN22_CANAL	5.12e-09	362	487	239	398	Alpha-1,2-mannosyltransferase MNN22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN22 PE=2 SV=1
sp|P38069|MNN2_YEAST	5.18e-09	185	302	172	297	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PUG3_T006702-RA-p1.