CAZyme Information: PUG3_T006216-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T006216-RA-p1
• CAZy Family: GH3
• CAZyme Description: Alpha,alpha-trehalose-phosphate synthase [UDP-forming]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
992		112693.78	6.8345

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC0443:17814-21440(-)

Full Sequence      

MKPQRRTTSSLQINALASGVPQAVASAPLMQRPTSPCFLAPRPLESPMTSRKSKTVLIVV
NWSSSATSMFYRNLVSETDKYSPLFIGCPEVFVAKSEEAAVEKQLRAFHCVPVFLDPTVA
HRYFQGFCKGVLWPVFHNVVDVYNSAKLTLDEYVVDCEESTEGDKKKERRESSGTNCWRD
PASWNPAAQDKCWSDYCSVNRTFAKRIIESYHDGDLIWIHDFHFLMLPSYLLRKVRTALV
AIYLHAPFPSSEIFRCLAVRTEILRAILCADHIGFLIFEHARHFLTSCKRLLGLNYTTSQ
NGMLVIEYNGRKINISCSHIEPDVSHLHDILEHVDDDKDALSFKKKIEKHIYDGDNKRKF
VIASVDRLEGLTALPLKLRAFDRFLSLHSDKRKSVVLVQIGLSLDSRPNDYHQTREYVLK
FAAEINRRWAPPGELVVYFEEKVKTTCMERMNLWSLSDTYLDTCVRSGLSLLPFEYIVAQ
KHKKEHMPDSSWPFGSMVVSEFASYSRILNGCLLVNPWKTDDIVNALVKATEMNYYERHN
RFQLNYKFLVMHSEQKWAERLLSDVESAVCKKQATEARETIDVGFGFDYRVMQFETGFVQ
LDLDDLVKKCTKSCRRLFVFDYGGTLSWTTSILDEDGAASCHRNGSVDGVMACSDLGDRK
TAFGQSVIRYIDGQVRTPLSDEARDNIRTLCNDPLNIVFVSSTGRRAELDAEFASIENLN
LISDNGFFLKKAGSTQWECLYKGVDLNLDWKDEVKRIMQSFAARTNGAYLIVNEVSLIYD
YRSCDPEYGEIQSLELYEQLRQVLKKGDATVYRGKGFVEVHQFGVNKATAMTLILSYMKE
KVGVPDFVFFAGDDESDELAFKALLTFAEHESALEHVFTCTVGMKPSCAKFYVDSVSDIL
TAVHAIAVRLRLESSRPTLFSKQSYFDQFVAQGPLVSPRFIRSLSVETDGTELLDALVPP
SSDHSIDTFAFPQPPTPTTPVPTPLRRFKLLS

Enzyme Prediction     

No EC number prediction in PUG3_T006216-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	48	566	6.2e-107	0.9473684210526315

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
177855	PLN02205	7.23e-140	79	907	103	845	alpha,alpha-trehalose-phosphate synthase [UDP-forming]
184712	PRK14501	9.03e-112	84	907	44	724	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	8.09e-107	84	566	44	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
215555	PLN03063	2.48e-104	85	908	55	785	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
395781	Glyco_transf_20	1.03e-101	82	566	45	469	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA19238.1|GT20	1.01e-147	86	899	323	1069
UIZ27356.1|GT20	3.20e-144	30	925	17	848
UIZ24099.1|GT20	9.07e-144	86	906	350	1118
AGT20052.1|CBM20|GT20	4.49e-120	93	868	227	952
AXH37639.1|GT20	4.02e-119	84	928	106	861

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVO_A	1.41e-66	47	565	21	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUV_A	1.59e-64	87	565	51	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	7.71e-64	87	565	51	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HVM_A	2.55e-63	87	565	59	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	2.73e-60	87	565	47	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q94AH8|TPS6_ARATH	3.89e-116	84	907	113	851	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 OS=Arabidopsis thaliana OX=3702 GN=TPS6 PE=1 SV=2
sp|O23617|TPS5_ARATH	1.57e-114	47	907	70	840	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 OS=Arabidopsis thaliana OX=3702 GN=TPS5 PE=1 SV=2
sp|Q0WUI9|TPS8_ARATH	5.32e-112	43	930	67	856	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1
sp|Q9LRA7|TPS9_ARATH	1.34e-110	51	931	74	862	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana OX=3702 GN=TPS9 PE=2 SV=1
sp|Q9LMI0|TPS7_ARATH	2.56e-108	84	921	103	843	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7 OS=Arabidopsis thaliana OX=3702 GN=TPS7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997392	0.002650

TMHMM  Annotations     

There is no transmembrane helices in PUG3_T006216-RA-p1.