CAZyme Information: PUG3_T006200-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T006200-RA-p1
• CAZy Family: GH3
• CAZyme Description: Glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		37354.44	4.5131

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC0441:17248-18475(+)

Full Sequence      

MTRLFSSVIGATAAIAGATLFSASGTEALQVFGLNYNSRLGPDWAPSETRCKSDASIQQD
MKTLKTVTNIVRLYSLVDCDQGTRVIPAAISAGLNVSVGLWVSGDANIFDIHVGSEAIYR
NDISVAQNIAYLDEIKALRDQYPQSKDIPVTIAEISDVYLAHSELVDAVDVVSANNFPFW
EKWNVATAAQRFQDRMTPLFALASSKGKRVVIGETGWASDGTSAKASTASPENALTYFRD
FYALAKQQRWEYFYFEAFDEEWKVATAVDATVEAHFGLFNANGTIKETFASVVLAESAAV
PDFSLSAEGGQAEASTSTSTSPAPSTSVPPSPSTSSNSNSSNHSRCNS

Enzyme Prediction     

No EC number prediction in PUG3_T006200-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	167	286	3e-23	0.45016077170418006

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.52e-40	39	282	49	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.39e-19	33	286	2	304	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28880.1|GH17	4.90e-81	20	288	5	296
CAJ90910.1|GH17	2.29e-80	8	307	4	326
AAM18482.1|GH17	5.45e-79	8	291	4	311
AIG56195.1|GH17	4.77e-72	28	300	17	318
CCA22143.1|GH17	3.11e-67	4	295	7	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.40e-25	30	286	28	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	9.78e-25	30	286	28	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AMT2|BGL2_CANAL	3.46e-28	51	286	35	300	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P15703|BGL2_YEAST	3.81e-28	13	286	8	305	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|P43070|BGL2_CANAX	9.25e-28	51	286	35	300	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|O13990|BGL2_SCHPO	2.67e-23	51	286	55	313	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|D4B2W4|BGL2_ARTBC	2.23e-19	50	282	36	292	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.271336	0.728629	CS pos: 28-29. Pr: 0.2238

TMHMM  Annotations     

There is no transmembrane helices in PUG3_T006200-RA-p1.