CAZyme Information: PUG3_T005813-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T005813-RA-p1
• CAZy Family: GH17
• CAZyme Description: Lysosomal beta glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
789		86468.67	5.1053

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC0397:16139-18508(+)

Full Sequence      

MTQLDIYSMVNGDVRDPARALNKDVVTKYAKAGIGSILNAPFNGRITDGRTGWSAAEWKQ
IIDQIQGIYKQYNQIPMIYGIDTIHGATYVRGATLFGQPISAASSFNLDLVFQMGEIEAK
DTLAAGIPWVFSPVLGIAVQPRWARVFETFGEDPYVSSRMGASIIRGIQSTGQVAACMKH
FIGYSNPASGLDRADNVISDWDLVNHFAPSFLAATLEGGVKTAMESYISINGEPVIASHR
LLTTLLRHDMNFTGMLVSDYSEIDRMHSEHHLVPSVADAVRVSLTETSLDMNMGPNMDDF
LNIVESLVASGTLSESRLDESVLRILQLKKDLGLLSQQNEKDNNVASPSSASAMDVGSAD
DQRVALALARESVILLENRNQTLPIQLSAGDENKNMSIFITGPISNNKGYMCGGWSVFWQ
GSSNSSHFPNGMTFKDAMIKRAAATTAQNIHIEHLDVVDVDGNMSGEDYGKAVDIASRSE
YTIVVLGEGNYAEKTGDIADLSLPEGQRKYLHSLTQLPYTKVIVVLITGRPRLLYGSHDD
ADAVLLSMLPCEQGGEALADIVFGDVNPSAKLPITYPIAEGKLLPYFHYVNTKCQPWDEC
PVQWEFGYGLSYTQFHYSDLKLNATTVDGADGALQVDVTIKNTGIVDGSEVVLLFVSQKY
RLAHIPETKLLKKFQKVHLKAQTATQVSFVLNVNDWGFYDPEIGTGFQRRFEAGEFEVSI
LQSLNEDQKLAATVAALNTSEGRDDGSDAPMGRDGQREFVSSRSRSQPRKVSSLRATFRV
LAHKTPRES

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	73	280	9.3e-56	0.9074074074074074

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	7.68e-99	74	720	103	750	beta-glucosidase BglX.
224389	BglX	9.96e-63	20	418	16	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	2.21e-60	90	692	108	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.03e-50	14	328	12	316	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	6.00e-37	373	612	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	2.82e-211	1	720	46	740
UIZ27116.1|GH3	5.80e-206	1	720	1	699
CCA27737.1|GH3	4.11e-188	1	720	84	783
UIZ29613.1|GH3	4.57e-185	1	720	90	795
UIZ29432.1|GH3	1.45e-183	1	720	45	739

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	2.25e-109	18	718	55	737	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
7EAP_A	8.65e-72	58	733	74	753	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5YOT_A	8.65e-72	58	733	74	753	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
5TF0_A	3.21e-70	19	720	41	736	Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
4ZOA_A	3.84e-68	65	703	72	692	Crystal Structure of beta-glucosidase from Listeria innocua in complex with isofagomine [Listeria innocua Clip11262],4ZOA_B Crystal Structure of beta-glucosidase from Listeria innocua in complex with isofagomine [Listeria innocua Clip11262],4ZOB_A Crystal Structure of beta-glucosidase from Listeria innocua in complex with gluconolactone [Listeria innocua Clip11262],4ZOB_B Crystal Structure of beta-glucosidase from Listeria innocua in complex with gluconolactone [Listeria innocua Clip11262],4ZOD_A Crystal Structure of beta-glucosidase from Listeria innocua in complex with glucose [Listeria innocua Clip11262],4ZOD_B Crystal Structure of beta-glucosidase from Listeria innocua in complex with glucose [Listeria innocua Clip11262],4ZOE_A Crystal Structure of beta-glucosidase from Listeria innocua [Listeria innocua Clip11262],4ZOE_B Crystal Structure of beta-glucosidase from Listeria innocua [Listeria innocua Clip11262]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	2.13e-134	1	720	96	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	1.62e-108	18	718	77	759	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|P33363|BGLX_ECOLI	8.17e-78	74	718	103	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|Q56078|BGLX_SALTY	5.36e-75	46	720	72	750	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	1.47e-70	77	727	68	713	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PUG3_T005813-RA-p1.