CAZyme Information: PUG3_T005352-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T005352-RA-p1
• CAZy Family: GH17
• CAZyme Description: Beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
933		106366.95	5.6257

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC0348:12252-15489(+)

Full Sequence      

MTANGLLPLLLLVWSSAFGAAQKLPLTTWRFQSHNGSIRIENASVPGTSHMHLQDAGLIQ
DPYLRFNEREYQWVAKETWIYETQFTVSDGDALQSSKLVFETLDGIAHVFVNDKHVAWTV
DSFMSYAFQVEKLLVRGMNAIKVKFVPPLDYALIQSEQYPYFVPATQNFNTWAEPTHRSF
IRKAGSDFGWDWGPAFATSGIAGNVYLEFGASAPELKNLDVIQEFPQGEHNLSIVQLTVQ
VSVDGKGSHHENVTFELFVNDVLQASKVTSVSPDQVEENAVNLSYTLENPTLWWPNGYGE
PYLYHVKVIARNERFNTSISHKTGVRHVALIQDDTVAGNTSGKTFYFKINQVPIFVKGAN
WIPTDSFPTRVQASNVKQLIRSAYEANMNMIRVWGGGRYESDDFYSECDRLGMLVWQELM
FACGMYPRDREFLELVNEEVRMQVKRLRKYTSIAIWGGNNENENMMEQFAEQDFMPPGTK
FNRDIAVADYSKLFVDLIQPIFSSLDSSRPFVDTSPSNGLYSVDPYVKRWGEVNGIAYGD
VHFYNYASDCQDPKTFPHARFISEFGFQSAPSKASLLEVSSDEDWGSFHSFWKFLKFRER
HENGTAQMLNQLQRRFAVPFPFSDEVWLSIPYSSRSSGSEFGFSVPGRVDSYLYLTQIQQ
ALCYQTAIRTWRRGKNADLGMTMGILYWQLNDIWQGTSWSSVEFSGRWKSLHYFVRREFA
PFIMSVHEDFTSDRIELYGVSDIPKNLDVEVVYELRKTKCGSVVKNITDTLSLSPLESKK
VQIFGVDELLAHKETSCTRKSCFIYVRCHSKAPETADSPSLCDDVYHFFAPYKSLHLEKG
VVEVVSVKASSSTSFAVTIQSSGFLALFVEVQSSYSRGFWSENSFLMLPRQTKELTFTGF
DDAQPSIDDFKKSLDVKWLQKIYEDAPFSAAME

Enzyme Prediction     

No EC number prediction in PUG3_T005352-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	28	785	9.2e-87	0.6848404255319149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	7.36e-66	29	905	19	798	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236673	ebgA	2.03e-11	78	461	110	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
395572	Glyco_hydro_2	3.82e-10	235	326	18	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
407625	Ig_mannosidase	7.94e-10	843	917	3	74	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
407658	Mannosidase_ig	1.75e-06	733	833	1	90	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA25641.1|GH2	1.16e-273	26	922	62	990
AIG55460.1|GH2	6.05e-235	22	923	24	862
AAH78052.1|GH2	3.06e-156	29	923	26	874
BDA42312.1|GH2	1.08e-151	29	926	39	924
AAC48665.1|GH2|3.2.1.25	7.27e-151	29	923	29	879

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DDT_A	4.59e-149	28	897	17	845	mouse beta-mannosidase (MANBA) [Mus musculus],6DDU_A mouse beta-mannosidase bound to beta-D-mannose (MANBA) [Mus musculus]
5N6U_A	1.33e-112	29	897	33	810	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	9.97e-102	27	899	13	818	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.04e-101	27	899	15	820	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.06e-101	27	899	15	820	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q95327|MANBA_CAPHI	1.29e-151	29	923	29	879	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
sp|Q29444|MANBA_BOVIN	5.41e-150	6	923	2	879	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
sp|Q8K2I4|MANBA_MOUSE	3.18e-148	28	897	28	856	Beta-mannosidase OS=Mus musculus OX=10090 GN=Manba PE=1 SV=1
sp|Q4FZV0|MANBA_RAT	1.40e-146	28	923	28	881	Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=Manba PE=2 SV=1
sp|O00462|MANBA_HUMAN	2.61e-146	9	923	6	879	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000285	0.999697	CS pos: 21-22. Pr: 0.8554

TMHMM  Annotations     

There is no transmembrane helices in PUG3_T005352-RA-p1.