CAZyme Information: PUG3_T004419-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T004419-RA-p1
• CAZy Family: GH16
• CAZyme Description: Endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
644		71230.07	8.3878

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC0260:29263-31535(-)

Full Sequence      

TYGSPQPLEPPASLLEHTDAASRLCPPKYLDPSVINNRAIPTNNWWGNIIAHDSGSKIQP
IWSNPYALQVVADLAPFGLAVSYPYRSRVSGGTSGNSGANRYYAHGILRELMFSSSEFAS
TKPEFRVLDWADQGVTVQLKSGAGKLESDLVSGMVYTTAKYTSLSPKLTSTATISSVNGK
AARSGDVFRGSKFEVSYNSGQTWVVYALSSDGTSDKEISLTVDGGSSLKASGSFNGILRT
ALAVENSWVPTLDTYRSCIVQGASVSTESDAAYSFNWKTMGNCASGLLHYAMAHHVDSMD
ASGSGPQKVAGMVTHSTTRGSFQAYATRPSSALVWKFSETQQVPSDFYPARKVPPSVIQS
QRILEHLRTDIAKTDWSIPKGGSYYFNGKAAQKYASLCLMANDAAIVGQDKSLLSQCLAK
LRTVMLPFVNNGWANKLQYDRVYRGIVSSEGYKKNDLNADFGNTMYNDHHFHYGYWIHTA
AMINLLDPSWSELNKLNTMANLLVRDVANFDDRDKYFPRFRSFDWFRGHSYSHGVTPLAD
GKDQESSSEDVNFSFGMYMFGKVTNQRDMMNVGKLMTRVNAHAIKTYFLMEDQNQVHPPN
FRPNKVTGIFFDNKVDYATWFSAEKYCIHGIQMIPITPVTEFIG

Enzyme Prediction     

No EC number prediction in PUG3_T004419-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	36	643	1.9e-168	0.864951768488746

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	4.73e-134	361	643	8	284	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	1.54e-133	26	644	79	685	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	1.85e-48	36	346	11	313	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20868.1|GH81	0.0	6	643	86	722
UIZ20873.1|GH81	0.0	6	643	86	722
UIZ20872.1|GH81	0.0	6	643	86	722
UIZ20875.1|GH81	0.0	6	643	86	722
CCA25006.1|GH81	2.44e-248	10	643	34	666

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.38e-96	36	643	37	652	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.36e-96	36	643	62	677	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	3.04e-93	36	643	37	652	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	8.33e-29	467	644	414	589	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	8.85e-22	379	644	355	613	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	2.27e-89	40	643	35	631	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	3.14e-84	40	642	226	826	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q12168|ENG2_YEAST	8.99e-78	40	643	111	707	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|P53753|ENG1_YEAST	6.11e-75	27	643	421	1040	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.67e-72	40	643	82	666	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999871	0.000135

TMHMM  Annotations     

There is no transmembrane helices in PUG3_T004419-RA-p1.