CAZyme Information: PUG3_T002193-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T002193-RA-p1
• CAZy Family: CBM48
• CAZyme Description: Endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
733	PultBR650_SC0098|CGC1	81417.05	4.8686

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC0098:16924-19766(+)

Full Sequence      

MPNENSPLLPSKLQDTTAHGRRKQRSVSQYLTRHTLIVVVPLAIVALVGLGWLFAGGSND
DSDDVEHVSTKTASPHGNITEYFNADVSFTGYSQKVSAGGNESSQSLLLGDGNTTSRSIA
AFDPLSVTLKYHFENEKPEEADHLFSAYLVRGSPYFTVEYQKIIPVLELNATLVAVNQEP
VQNVDEPTGAYKSWTSKRFELDVQVYGADKGANAPQKWILYFAQERTLQLQFANEKDYRL
YNLRGEITTPTNVRLVDMDFYTGPVRVAIVPSDEAIALLDASASVYPVASSVNTSVEGLN
GFATLNWETKRFEGTNASDANLLMLANPHHADSFSTHQSDASFKVLTKLGHRTETLPNID
FDTTQPIAKPEYLEAIKVSLANDSNYTPIAQDPYFFGKEVGRQARLALIADTVGNETLRD
TLLDSLEEWLTPWLVGSNDNHFVYDDTWGGLCSKNGLKGVFWMTDFGNGWYNDHHFHYGY
LLYSVAVVTKFRPAFGETHKAPIVAIARDIASSSADDKYFPFARHFSWFDGHSFASGVYT
LDGGKSQESVSEAINAYYGVYLVGKALKIPEVEHMGHLLMSLEIRAAKTYWQMSSGSDIY
EDVYAQNKMTGQIAATKVSYTTWFGPEIEHMHLINMIPFTPITEAFISPAYVQEEYPVLQ
KEAFDRQVDPIEKRWSGYAYLDLAIINPVKAWSLVSDLDFFDDGNSLTNSLFWIATRPTA
GNSTASAVAAPAN

Enzyme Prediction     

No EC number prediction in PUG3_T002193-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	93	713	5.7e-138	0.9035369774919614

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	2.73e-98	370	711	4	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	8.26e-70	149	711	197	749	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	3.88e-17	87	335	52	275	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA19047.1|GH81	1.15e-216	64	717	133	815
UIZ24045.1|GH81	1.24e-158	64	512	143	606
UIZ24044.1|GH81	1.04e-115	519	719	6	206
CAN97272.1|GH81	1.13e-95	115	718	159	718
UQA58532.1|CBM6|GH81	2.04e-95	119	718	368	921

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.32e-62	117	718	129	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.84e-62	117	718	154	744	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	4.24e-61	117	718	129	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	8.28e-37	388	721	334	660	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	2.16e-25	388	705	355	672	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	3.10e-50	216	706	390	891	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.41e-48	247	708	208	693	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.90e-48	247	706	248	726	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	4.79e-47	265	711	632	1100	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	3.87e-43	265	715	661	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999957	0.000048

TMHMM  Annotations     

Start	End
30	52