CAZyme Information: PUG3_T002075-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T002075-RA-p1
• CAZy Family: CBM25|GH13
• CAZyme Description: Alpha,alpha-trehalose-phosphate synthase [UDP-forming]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
253		29034.67	4.9238

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC0091:6761-7828(-)

Full Sequence      

MTTRVKPMDPQTRATDDVANGWNTSMPVIIAANRLPVXXXXRGSIQRRSSIDVNEDSYAA
EKRDDAQGDSDGEQETNTFSHHEISERAXXXXRFVGRISELAVPVDEQRELARKLQEFNC
YPVFVEQHEAKLYYEDYCKQTLWPTXXXXVVDVYSPVDVVLDVGETSSETKDAPKICELY
EPGDIIWVQDYHLLLTPSYIIRKVRGANVGLFLHVPFPSSEVFRTLSARKEILRGMLNAD
HIGFHLFEYVYHL

Enzyme Prediction     

No EC number prediction in PUG3_T002075-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	26	252	4.2e-43	0.42526315789473684

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	2.57e-46	99	252	51	204	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	5.17e-46	103	252	54	208	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
184712	PRK14501	2.51e-44	106	252	59	203	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
223457	OtsA	1.75e-39	105	252	72	217	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
177855	PLN02205	1.10e-35	9	253	43	272	alpha,alpha-trehalose-phosphate synthase [UDP-forming]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27356.1|GT20	7.88e-80	22	252	18	254
AGT20052.1|CBM20|GT20	7.35e-40	103	252	227	384
QOX06485.1|GT20	1.08e-36	101	252	126	283
AJA04606.1|GT20	7.35e-34	103	252	181	336
AGT80036.1|GT20	7.35e-34	103	252	181	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVO_A	2.02e-28	101	252	62	217	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUV_A	3.26e-26	101	252	55	209	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	3.26e-26	101	252	55	209	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
6JBI_A	4.69e-24	101	252	51	205	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVM_A	8.19e-24	101	252	63	217	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0WUI9|TPS8_ARATH	5.60e-30	94	252	104	266	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1
sp|O23617|TPS5_ARATH	6.50e-29	94	252	106	268	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 OS=Arabidopsis thaliana OX=3702 GN=TPS5 PE=1 SV=2
sp|Q94AH8|TPS6_ARATH	1.20e-28	94	252	114	276	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 OS=Arabidopsis thaliana OX=3702 GN=TPS6 PE=1 SV=2
sp|O80738|TPS10_ARATH	3.00e-28	103	252	114	268	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 OS=Arabidopsis thaliana OX=3702 GN=TPS10 PE=2 SV=1
sp|Q4WHW0|TPS1B_ASPFU	1.04e-27	101	252	62	217	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=tpsB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PUG3_T002075-RA-p1.