CAZyme Information: PUG3_T002074-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T002074-RA-p1
• CAZy Family: AA6
• CAZyme Description: Alpha,alpha-trehalose-phosphate synthase [UDP-forming]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582		66329.83	7.7740

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC0091:4116-6561(-)

Full Sequence      

MAIDAQRIEETLSEELVREKVVALRQKYIGKKIFAGCDTVERLKGIPCKLFAFDARCPDF
IGKVVLVQKGIHRRGRITDYSQSKKEIELIVQSVNNKYRERAKGDVVDYEEVAEFPFKDR
IALWRVADVQMTTVLRDGLNTIPFEYIIAHNRLLSGAITVNPWELDQVIDALRDAVYMSQ
KEREYRRDCDFQFVSSNPPRRWAKCVLSDIVNARKKEDMFVYMGTGFGLDFRVMEVSANF
RKLTEQEIAPAYKTSKARAIFIDYYRTLAPDVSKVMGVRWPDVPLNALSTLEHLCKDPRN
TVFIVSGCNCDLLTQKFGGVPGLGLVAEHGYFIQRALLGNDARIGRRWEHHGDLFNTEAS
SRSWREKAEHIIEMYVDRTNGSSLELRKSAVLFRYGKSDFEFGALQAAELKEHLEGVFQG
WPLDVIQGKDYIEVRPEGVGKGKVIEHILDKMRVDGNPADFVLCIGDDVADELMFEKLNE
MIANTELPREKVFTCTVGQKPSKAEFYLDDYTDVIALLKSLKVVSTKSNRNYSLSDMQSF
MRDSRPLISSSIQTAGFTRNANSDSSFRRTSSRYALHNNSCA

Enzyme Prediction     

No EC number prediction in PUG3_T002074-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	2	210	3.9e-46	0.47157894736842104

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
177855	PLN02205	2.58e-109	1	527	307	850	alpha,alpha-trehalose-phosphate synthase [UDP-forming]
184712	PRK14501	4.47e-81	1	521	235	723	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
215555	PLN03063	4.48e-69	1	533	249	795	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
215556	PLN03064	7.41e-60	3	521	335	926	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
396780	Trehalose_PPase	1.14e-53	261	510	1	231	Trehalose-phosphatase. This family consist of trehalose-phosphatases EC:3.1.3.12 these enzyme catalyze the de-phosphorylation of trehalose-6-phosphate to trehalose and orthophosphate. The aligned region is present in trehalose-phosphatases and comprises the entire length of the protein it is also found in the C-terminus of trehalose-6-phosphate synthase EC:2.4.1.15 adjacent to the trehalose-6-phosphate synthase domain - pfam00982. It would appear that the two equivalent genes in the E. coli otsBA operon otsA the trehalose-6-phosphate synthase and otsB trehalose-phosphatase (this family) have undergone gene fusion in most eukaryotes. Trehalose is a common disaccharide of bacteria, fungi and invertebrates that appears to play a major role in desiccation tolerance.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27356.1|GT20	0.0	1	576	291	882
CCA16404.1|GT20	9.00e-249	1	538	287	843
VDD06791.1|GT20	1.51e-101	1	532	303	849
CAG7899391.1|GT20	1.51e-101	1	532	303	849
VDD56631.1|GT20	4.13e-101	1	542	303	859

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXN_A	4.69e-38	243	521	6	269	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 2 [Aspergillus fumigatus Af293],5DXO_A Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293],5DXO_B Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293]
5DXL_A	6.12e-37	243	521	6	269	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 1 [Aspergillus fumigatus Af293]
5DX9_A	1.50e-31	243	478	6	223	Chain A, trehalose-6-phosphate phosphatase [Cryptococcus neoformans]
5DXI_A	9.39e-28	252	481	17	247	Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314],5DXI_B Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314]
5HUT_A	3.28e-24	1	219	242	476	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9LRA7|TPS9_ARATH	1.10e-99	1	532	304	850	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana OX=3702 GN=TPS9 PE=2 SV=1
sp|O80738|TPS10_ARATH	4.04e-97	1	530	304	848	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 OS=Arabidopsis thaliana OX=3702 GN=TPS10 PE=2 SV=1
sp|Q0WUI9|TPS8_ARATH	5.11e-97	7	521	308	834	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1
sp|Q94AH8|TPS6_ARATH	1.16e-94	1	525	312	854	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 OS=Arabidopsis thaliana OX=3702 GN=TPS6 PE=1 SV=2
sp|O23617|TPS5_ARATH	6.39e-94	1	526	304	844	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 OS=Arabidopsis thaliana OX=3702 GN=TPS5 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PUG3_T002074-RA-p1.