CAZyme Information: PUG3_T001507-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T001507-RA-p1
• CAZy Family: AA17
• CAZyme Description: Methyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1187		135028.43	5.4136

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC0060:7358-10972(+)

Full Sequence      

YAELLRQTHSSTEQQSVNELKQQAIRHYERALNADLLWNDGVTDNTTNLVLQNRFHVLNT
IGMLLMDLHELEASISFFERAAAADPTAVHPLGNMALALINMGEMEAALRINEQALRLDP
NRSHLLHNMGNILHALGREDEALEHFKHAYQLNPNEPETLNSIAIYYAVNGDMNEALQFL
QRTFAIAEAALAENPSHYEAIIAYNCAQLRLANARLPLVYQSVDEIAEARSQYMSSLEAL
LNESSAPLVLPDPVNSVSIGSMGYYAVYQGFNDVGIRSQLTRVYRKGAPTLSFTAPHVLH
DRNKTYQFTFPSPPSSRMNRKSRRIAKRYTKYSNETVHVNRRIRVGFHSGLMRQHSVGLL
TQGVITKLPRDAFEVIVIIYDNDERDDLTELVLRSADSVVFLRQELDQAQRQISDLELDV
LVFTEIGMHIRTYFLAFSRLALRTAMFWGHAVTSGIDSVDYFVSSKRFHDDRAEKLFTNK
SQGDVTEQQSKYTECVYEMDHLTTYFFEPLASQDQLTPPFHALLRESLGLPPKDVLPIMI
LVPQTLYKLHPDFDRLIERVLASVPETSFLAVPIGFMPWLADVYKRVYFLRRLNTTEFLD
VCAMADLVLDPFPVGGGRSSFEIFAVGTPIVMLAPRTTILQLTEAMYNVMGVADLIAYSE
DEFVEITVLLAQDEKLRTQARELILKHKHKLYENAVVIREWETFLISILAAKPPQERASD
HATSAARVTGECPHALPLIPVNEPFFELNVFLFGVVDHDNHLVGVTLTLPSEEDDPFEVS
EELAERFEPPLDSLQQNFVAKTMWNAKHRQSQPVVMTVNVSVTANVYVPVEIRYGDDLHV
ALLMHLEKHRSKMDERIHSVWQIPQVIEVAAGQLQQLLPEYSSPAWIAARSFPLRFSNAS
NHDAQRNARRECVTLVMTTCKRLSLFLRTIASLQRALGIALESDWSKWFCHLLIVDDNSS
PADRDAMKAHLPQSVEFLYKTPDQRGYAKSLNLAIGRVQSQFVFYLEDDWEFVNYTTREG
NDTSSASTFLDDALTVLRDNSRREYEPLAQVLLKNYEGGWSRQLGSIRYFVHEFAASDPT
LSFAFWPGFSLNPGLWDLGAILEAMEWDDTIDRPRQRPIFDEVSDRFETLFACELWRTGL
RVAYLDGEFISHTGAPLGTNASAYVLNDLPRRFDFVESFARSAFPLR

Enzyme Prediction     

No EC number prediction in PUG3_T001507-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	113	707	1.1e-62	0.5617021276595745

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	2.30e-32	104	684	6	588	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
276809	TPR	5.79e-19	92	182	4	94	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	2.11e-18	57	151	3	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	4.14e-13	125	238	3	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
223533	TPR	4.43e-13	64	204	139	276	Tetratricopeptide (TPR) repeat [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ32129.1|GT41	1.15e-54	208	724	480	938
QEG14440.1|GT41	1.15e-54	208	724	480	938
QDU12502.1|GT41	1.15e-54	208	724	480	938
BAP54338.1|GT41	3.68e-54	208	707	138	584
QDT18528.1|GT41	9.76e-53	216	727	488	935

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DJS_A	6.14e-10	340	682	160	487	Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_B Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_C Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_D Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum]

Swiss-Prot Hits     

PUG3_T001507-RA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999778	0.000256

TMHMM  Annotations     

There is no transmembrane helices in PUG3_T001507-RA-p1.