CAZyme Information: PUG3_T001095-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T001095-RA-p1
• CAZy Family: AA17
• CAZyme Description: Alpha mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
954		107556.74	6.1960

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC0041:26936-29890(+)

Full Sequence      

MSALRSRHEARKQRHMLLLTLVSVLLLLCDQDSTRIVGASVAPSPSGRLDAPSRHHVELS
QHSEPDPSAYGSNTSSPRTRWSRIRYPLDGSVNVNPVAFRCEFTSDNFANFQRQTASALL
CVEVDHKWIQCQPVSQTPSEFPELPAGDHTAVAFLTAREQGARSNESEAITFTIMTPTEY
ERYVERRKEQEREAYALPEEQDLLTWAANHNSIEEAHVHWNGDVMRDTRVSFQQNLPDPL
ILLIGVKTSHAKLFFVGCQPVLSNSDLRSEETADNSNAELLRAIEKEKHTYGDLLTHELA
CQDSYFALVDKVKAFMHFAVTQFPTAQYVMIADDDIYLRTDQLVHVLQVHGPRSRVYVGQ
VWAKQFMAPMYPMRSPTHKNYLPEEQYPMSELPPFAFGPHYFISMDCAAFIADNRDELRG
LAALDDVSVALWLLALQVHPEHVEHFQNLRDTSCTEGLISLADLSPSAIRIIHANLHADA
PFCRGADLTTWRKAERPFRAAETKRKFTVTTKIAMHTNGLQVMTTFTIDSAGSIEFAYSP
SRESVEQHAAAICEHLQPSLVYKFDCSSDVTPKVHSSMAASLEHTMENREINPAFLDLWT
HNLQLFRPDATVPAPAAKIVVYSRNAMFSKTLLECLFASVYTLNSVFVVDETTFHQHPEY
QGVSPDVVVFSILDGNCWSGWDPRCRQAVADYVQLYGSTSSLVMISGEAWDVDGLDESVL
LISTVAHVPRRKHVYIPMASLSFGERLIQSPLLLLANTDNGPSSLLEEPQSQLTHRKFCA
YMYARCDRPQREYMFDLLSAMEPVDALGACQGSSRAPNEKRWTGRSSIWYNDDAVRLYSQ
YKFVIAFENGQHPGYVTEKLVNAFLAGSVPIYFGHSESVAQVFNSESFIDCGRFAMLREC
AAFVIEVHRSPAKYAHMARAPVIANVSLFHELFSWHPDIPSSHLSDRIRELLLK

Enzyme Prediction     

EC	2.4.1.122:14	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	768	919	6.5e-37	0.40634005763688763
GT31	277	442	1.9e-33	0.828125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
250845	Galactosyl_T	7.61e-25	272	444	29	196	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.
395683	Glyco_transf_10	2.61e-16	790	914	17	130	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).
215596	PLN03133	1.23e-09	254	454	423	619	beta-1,3-galactosyltransferase; Provisional
178735	PLN03193	7.48e-08	280	444	194	349	beta-1,3-galactosyltransferase; Provisional
140237	PTZ00210	7.14e-04	303	367	177	240	UDP-GlcNAc-dependent glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWP29999.1|GT10	1.19e-19	735	921	84	265
QWP06209.1|GT10	1.19e-19	735	921	84	265
QWP23613.1|GT10	1.19e-19	735	921	84	265
AYR27354.1|GT10	5.30e-19	778	921	128	265
QWP59341.1|GT10	1.29e-18	778	921	128	265

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	1.21e-13	770	917	174	307	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	9.26e-13	770	917	174	307	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5UQ63|YR654_MIMIV	5.47e-17	764	925	405	570	Putative fucosyltransferase R654 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R654 PE=3 SV=1
sp|A7XDQ9|B3GTK_ARATH	1.95e-13	260	483	463	680	Hydroxyproline O-galactosyltransferase GALT2 OS=Arabidopsis thaliana OX=3702 GN=GALT2 PE=1 SV=1
sp|Q7JK26|B3GT1_PANTR	9.83e-13	275	448	121	282	Beta-1,3-galactosyltransferase 1 OS=Pan troglodytes OX=9598 GN=B3GALT1 PE=3 SV=1
sp|Q7JK24|B3GT1_GORGO	9.83e-13	275	448	121	282	Beta-1,3-galactosyltransferase 1 OS=Gorilla gorilla gorilla OX=9595 GN=B3GALT1 PE=3 SV=1
sp|Q7JK25|B3GT1_PANPA	9.83e-13	275	448	121	282	Beta-1,3-galactosyltransferase 1 OS=Pan paniscus OX=9597 GN=B3GALT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.008733	0.991240	CS pos: 38-39. Pr: 0.6417

TMHMM  Annotations     

There is no transmembrane helices in PUG3_T001095-RA-p1.