CAZyme Information: PUG3_T000312-RA-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PUG3_T000312-RA-p1
• CAZy Family: AA17
• CAZyme Description: Transmembrane and TPR repeat-containing protein 3 (Protein SMILE).

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
764		84742.18	9.2588

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumBR650	14086	1223559	0	14086

• Gene Location: location=PultBR650_SC0009:37974-40572(-)

Full Sequence      

MAPWPSAVTSSFLITAAAMTAAWNAHENGFVWDDRAAILGNKDVHSGGNGTALWNSYRPL
TVLSFRMNHLLTGYDARYFHAVNTLVHAGCSLLVWKVANVLFAATKKRAEGAHAGNAASS
SNFNGMGALLSGLLFAVHPIHCDAIASVVGRADLLCTLLALQSFLIYVDAVESSRWTAVG
LALITAVGGKNLHTSLCKELGFTAFGLFVAYDIVFYFSSQYSVDDRERKIKRIRVAGQRI
AVVTLFVLLFAVVRVWINGEHRQMKWTILANNVVVQQSKLTRMLSYAHIHAWYLWKLVWP
RSLCFDYGFKTVPVITTIWDPLNLYTLAAYSVVLAGVVVGIKQIASSPLLMCIAFGVIPF
IPASNLFFPVGTVVAERLLYFPSVGFCLLIGLKVQGALAISYKYGAIPHYDDDNEENDVH
LGPKKTHHGKKYTGHTSLFRRCYASICICCSVLVLCGCYRSRLRNAEWVSETSLFEAAVK
IAPMNNKVLSNVGKTLLHHDNELAIKYLRVATAILPHQIEGHTNIGLAYWAQEGWLLATR
HLYKSTHFGPMHFQGIGYFGAVLLDTWLGEGRTLGRMTKDFLSSPTIQNANRYLERAISM
GSTYPMHYYTRSRIAYFEGEYEDAIRFSNAALQVNEHIHNQSIDKELIMNPGQIYNMIAV
SYMAQGKKDLALKTILAGLEVDPNDIDLHINAAIIYVNRNHLNEGNQHIEAGLQSATPKH
VPILHTAAELMEAIHQLDAAAAFRQRAKSLLASRAKKVKILRAT

Enzyme Prediction     

EC	2.4.1.109:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT105	67	217	1.5e-28	0.9312977099236641

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400627	DUF1736	2.45e-17	278	334	18	74	Domain of unknown function (DUF1736). This domain of unknown function is found in various hypothetical metazoan proteins.
276809	TPR	6.18e-09	608	714	4	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
274350	PEP_TPR_lipo	2.45e-08	476	763	251	538	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.
276809	TPR	7.20e-08	653	747	2	95	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
274350	PEP_TPR_lipo	6.78e-06	561	764	48	235	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE38405.1|GT105	6.51e-56	13	732	16	647
BAC32122.1|GT105	3.56e-53	13	697	16	613
CAH18164.1|GT105|2.4.1.109	6.71e-52	23	732	21	643
BAC25886.1|GT105	4.36e-51	25	509	36	506
BAG63967.1|GT105|2.4.1.109	7.31e-51	23	732	21	642

PDB Hits     

PUG3_T000312-RA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8BRH0|TMTC3_MOUSE	2.74e-53	13	697	16	613	Protein O-mannosyl-transferase TMTC3 OS=Mus musculus OX=10090 GN=Tmtc3 PE=1 SV=2
sp|Q6ZXV5|TMTC3_HUMAN	5.33e-52	23	732	21	643	Protein O-mannosyl-transferase TMTC3 OS=Homo sapiens OX=9606 GN=TMTC3 PE=1 SV=2
sp|Q8BG19|TMTC4_MOUSE	4.77e-51	25	509	36	506	Protein O-mannosyl-transferase TMTC4 OS=Mus musculus OX=10090 GN=Tmtc4 PE=2 SV=1
sp|Q5T4D3|TMTC4_HUMAN	5.49e-50	4	507	21	504	Protein O-mannosyl-transferase TMTC4 OS=Homo sapiens OX=9606 GN=TMTC4 PE=1 SV=2
sp|Q7K4B6|TMTC3_DROME	1.20e-49	14	614	40	640	Protein O-mannosyl-transferase Tmtc3 OS=Drosophila melanogaster OX=7227 GN=Tmtc3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.768016	0.231989

TMHMM  Annotations     

Start	End
200	219
240	257
317	339
346	368
378	400
437	459