CAZyme Information: PTTG_28970-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_28970-t43_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1036		115336.67	6.1234

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000163.1:27510-31996(-)

Full Sequence      

MSVLVGRREGWAPPFEISTTNQTSQQRATAGRRRMTTAPPGHTQTRNTRHRTRRRKALPL
MPPISCGLLAVLLLLLVRHAEARMSAGRKLELRDLVKKTWYHGFDHYMKHAYPDDELRPL
SCTGMGYDHENPNNHETNDVLGDFSMTLIDVLDTFVALGDRANFRLAVIRIVEQMASFDL
DSKVQVFETTIRVLGGLLSGHLFAKDPDNLWGFRIDGYDDQLLVLAKDLADRLVPAFQAS
PTGIPYARINLRHGVLQGEGTETCTAGAGSLLLEFATLSRLLGDPVYENVAKKAFYALWD
RRSAINLFGNTIDIQTGYWAYGVSSIGAGIDSFYEYILKSHVLLQDDSFLEMWNQAYKAV
MTYMRSPDGFWYRGVNMQTGAVATTTIDSLSAFWPGLQVLAGDIEAAIQSHMTYANLWAR
YSGIPEVFDVHKKQATSLGYPLRPEFVESNYFLYRATKDEYYLDVAERVITDLVNRTWVD
CGLASIANLLTGKLEDRQHSFMLSETLKYLYLTFDEDNPINHADQPFVFTTEGHILYIPD
AQDMPENLGRRTGWEERESLESDRVAWTAPPRNRTRRASVAQTCSVFAPSLQSAKHSNPL
MLSITGRSDFDYARMITGSLDAPINSTHAVDRLDERWASCGMCEVPVADDHLIELIFSHS
AEDIERNPGPDKVEFFGPSSASSAPGTGPPEPKRNMVPLDSHASFESSPSSPAFVLVKNL
TGLTFSLRKRFDQDSYEIVKVGAYELSPKTQVVLSDPYAIKVLQPQNESEQVSQRDRDHL
TGIRVYYEGSVISQEPSQDMVSMSRAVMMATFGPDVRKNGSTDLSLGNLPLEVVGLNPPN
EYGCMPIPAPGFAPTRERPEDVRGKVLLVKRGECTFADKVEAAVAAGARAIIVANEDDTL
LIPTSDRIQSRDAKENLVLTHSAPPPSSSEAPAPTEQLSTPVDVHHHHEKLKSIPLLFST
LETGRSIGTMLANRQPLLPGSLRNRKLLIEIVDNPLDLLTHPETTSATSTHHQPIDDPSK
YIVINGYKLSNLILKK

Enzyme Prediction     

EC	3.2.1.113:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	101	537	1.3e-136	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	9.68e-145	101	536	3	451	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.33e-71	93	542	73	522	glycoside hydrolase family 47 protein; Provisional
240122	PA_subtilisin_1	2.40e-07	810	904	3	93	PA_subtilisin_1: Protease-associated domain containing subtilisin-like proteases, subgroup 1. A subgroup of PA domain-containing subtilisin-like proteases. The significance of the PA domain to many of the proteins in which it is inserted is undetermined. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Proteins into which the PA domain is inserted include the following subtilisin-like proteases: i) melon cucumisin, ii) Arabidopsis thaliana Ara12, iii) Alnus glutinosa ag12, iv) members of the tomato P69 family, and v) tomato LeSBT2. However, these proteins belong to other subtilisin-like subgroups. Relatively little is known about proteins in this subgroup.
238300	PA	5.27e-06	821	914	10	98	PA: Protease-associated (PA) domain. The PA domain is an insert domain in a diverse fraction of proteases. The significance of the PA domain to many of the proteins in which it is inserted is undetermined. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Proteins into which the PA domain is inserted include the following: i) various signal peptide peptidases including, hSPPL2a and 2b which catalyze the intramembrane proteolysis of tumor necrosis factor alpha, ii) various proteins containing a C3H2C3 RING finger including, Arabidopsis ReMembR-H2 protein and various E3 ubiquitin ligases such as human GRAIL (gene related to anergy in lymphocytes), iii) EDEM3 (ER-degradation-enhancing mannosidase-like 3 protein), iv) various plant vacuolar sorting receptors such as Pisum sativum BP-80, v) glutamate carboxypeptidase II (GCPII), vi) yeast aminopeptidase Y, vii) Vibrio metschnikovii VapT, a sodium dodecyl sulfate (SDS) resistant extracellular alkaline serine protease, viii) lactocepin (a cell envelope-associated protease from Lactobacillus paracasei subsp. paracasei NCDO 151), ix) various subtilisin-like proteases such as melon Cucumisin, and x) human TfR (transferrin receptor) 1 and 2.
240117	PA_1	6.98e-05	835	903	13	93	PA_1: Protease-associated (PA) domain subgroup 1. A subgroup of PA-domain containing proteins. Proteins in this subgroup contain a RING-finger (Really Interesting New Gene) domain C-terminal to this PA domain. The PA domain is an insert domain in a diverse fraction of proteases. The significance of the PA domain to many of the proteins in which it is inserted is undetermined. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Proteins in this group contain a C-terminal RING-finger domain. Proteins into which the PA domain is inserted include the following: i) various signal peptide peptidases: such as hSPPL2a and 2b, ii) various E3 ubiquitin ligases similar to human GRAIL (gene related to anergy in lymphocytes) protein, iii) various proteins containing a RING finger motif such as Arabidopsis ReMembR-H2 protein, iv) EDEM3 (ER-degradation-enhancing mannosidase-like 3 protein), v) various plant vacuolar sorting receptors such as Pisum sativum BP-80, vi) prostate-specific membrane antigen (PSMA), vii) yeast aminopeptidase Y viii) Vibrio metschnikovii VapT, a sodium dodecyl sulfate (SDS) resistant extracellular alkaline serine protease, ix) various subtilisin-like proteases such as Cucumisin from the juice of melon fruits, and x) human TfR (transferrin receptor) 1 and human TfR2. The proteins listed above belong to other subgroups; relatively little is known about proteins in this subgroup.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW05174.1|GH47	1.69e-200	88	906	48	787
QRV76268.1|GH47	1.52e-196	88	906	48	787
CDR48801.1|GH47	1.68e-189	85	918	35	870
QRW19457.1|GH47	3.27e-185	88	921	47	851
CDR48802.1|GH47	5.44e-184	85	653	35	594

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4AYO_A	2.12e-49	96	536	17	433	Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 [Caulobacter sp. K31],4AYP_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with thiomannobioside [Caulobacter sp. K31],4AYQ_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with mannoimidazole [Caulobacter sp. K31],4AYR_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with noeuromycin [Caulobacter sp. K31],5MEH_A Crystal structure of alpha-1,2-mannosidase from Caulobacter K31 strain in complex with 1-deoxymannojirimycin [Caulobacter sp. K31],5NE5_A Crystal structure of family 47 alpha-1,2-mannosidase from Caulobacter K31 strain in complex with kifunensine [Caulobacter sp. K31]
5KKB_A	4.52e-41	91	538	21	467	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	5.32e-41	91	538	19	465	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
1DL2_A	1.08e-38	91	554	4	509	Crystal Structure Of Class I Alpha-1,2-mannosidase From Saccharomyces Cerevisiae At 1.54 Angstrom Resolution [Saccharomyces cerevisiae]
5KIJ_A	1.79e-38	96	538	9	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94726|MNL1_SCHPO	4.38e-150	64	567	7	506	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
sp|Q92611|EDEM1_HUMAN	2.40e-138	89	540	127	588	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1
sp|Q925U4|EDEM1_MOUSE	2.90e-138	89	538	122	581	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1
sp|Q9FG93|MNS4_ARATH	5.04e-120	91	538	39	473	Alpha-mannosidase I MNS4 OS=Arabidopsis thaliana OX=3702 GN=MNS4 PE=1 SV=1
sp|Q9SXC9|MNS5_ARATH	4.65e-119	88	565	33	514	Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999968	0.000079

TMHMM  Annotations     

Start	End
58	80