CAZyme Information: PTTG_28836-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_28836-t43_1-p1
• CAZy Family: GT69
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241		25821.64	7.9224

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000143.1:143080-144029(+)

Full Sequence      

MLLSNRLATAFAFLNLLNSSVIVGAFQAEEVSFQAAASVKADPTSPCGLYQIVAARGTNE
AQSGSPTYANLINIIETTIPGGSNVEIDYSAIMEYVTSPIKGAAAGAAYLSDQMVKCPDQ
KYVFVGYSKGAMVISQLMKELPISADKVVAIVLFGNPFHTPNAPQNRCSGSGGSGLASYF
APPIPSQYVSLTYDCCILWDMVCQTIGTVFNHLKYRGSQDEKNAAAFVVSQLRRKLGRMY
K

Enzyme Prediction     

No EC number prediction in PTTG_28836-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	47	232	3.7e-31	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	9.63e-19	46	232	1	173	Cutinase.
369775	PE-PPE	0.002	104	157	30	89	PE-PPE domain. This domain is found C terminal to the PE (pfam00934) and PPE (pfam00823) domains. The secondary structure of this domain is predicted to be a mixture of alpha helices and beta strands.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SAM69077.1|CE5	8.67e-18	35	232	14	222
SOD71098.1|CE5	1.52e-16	37	232	42	251
BBB03504.1|CE5	1.69e-16	47	215	29	204
BAN66731.1|CE5	1.69e-16	47	215	29	204
SDI85539.1|CE5	2.92e-16	37	232	42	251

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7CC4_A	3.54e-18	47	215	3	178	Chain A, Cutinase-like enzyme [Moesziomyces antarcticus],7CC4_B Chain B, Cutinase-like enzyme [Moesziomyces antarcticus],7CW1_A Chain A, Cutinase-like enzyme [Moesziomyces antarcticus],7CW1_B Chain B, Cutinase-like enzyme [Moesziomyces antarcticus]
7CY3_A	5.73e-06	45	232	15	193	Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY3_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY9_A Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9],7CY9_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9]

Swiss-Prot Hits     

PTTG_28836-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000458	0.999510	CS pos: 25-26. Pr: 0.9192

TMHMM  Annotations     

There is no transmembrane helices in PTTG_28836-t43_1-p1.