CAZyme Information: PTTG_28165-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_28165-t43_1-p1
• CAZy Family: GT48
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
520		57810.27	7.1808

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000092.1:105364-107438(+)

Full Sequence      

MKYDYVIVGGGTAGCVLAHRLSEDPNISVLVIEGGPNDQNLDSVLQLKNWINLLNGPLDY
SYPIKEQARGNSHIIHSRAKVLGGCSSHNTLISFFPFPEDVDDWVQAGAQGWEWDKFKVY
AGRVKSHIQPVAKKDQNSLAGAFIDATHDALNLPKIADFAQWMKAGGQSPWREGVGWLSV
AYHPETGTRSSASVAYVHEILGKRNNLTIWFEAWTSKLVVSGPQKAVTGVEVELKDGRKV
FVKAKKEVCLCAGAIDSPRLLLLSGIGPRKQLEDLNIPVVHHLPGVGENLLDHPETIIMW
RTGPQPLQTVMKSEVAYFNRRPVATDSRPDMMSHIYQIPFAENTERLGYPRPEHAFCVTP
NIPRPKSKGKLYLTSSDPKVKPELDFQYFTDPEDYDAKVLVDGIKQARLIAQSEPFKSWL
LEEVAPGPKVQSDEDLSLYARKASHTVYHPAGTCKMGSVEDEMTVVDPNMRVKGLKNIRI
IDASIFPSMISVNPMITVMMIGEKASDLILKDYYNTPSKL

Enzyme Prediction     

No EC number prediction in PTTG_28165-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	2	517	1.7e-95	0.511326860841424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.42e-117	1	510	4	532	choline dehydrogenase; Validated
225186	BetA	1.78e-116	1	512	6	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
273814	betA	2.13e-100	4	510	1	527	choline dehydrogenase. Choline dehydrogenase catalyzes the conversion of exogenously supplied choline into the intermediate glycine betaine aldehyde, as part of a two-step oxidative reaction leading to the formation of osmoprotectant betaine. This enzymatic system can be found in both gram-positive and gram-negative bacteria. As in Escherichia coli, Staphylococcus xylosus, and Sinorhizobium meliloti, this enzyme is found associated in a transciptionally co-induced gene cluster with betaine aldehyde dehydrogenase, the second catalytic enzyme in this reaction. Other gram-positive organisms have been shown to employ a different enzymatic system, utlizing a soluable choline oxidase or type III alcohol dehydrogenase instead of choline dehydrogenase. This enzyme is a member of the GMC oxidoreductase family (pfam00732 and pfam05199), sharing a common evoluntionary origin and enzymatic reaction with alcohol dehydrogenase. Outgrouping from this model, Caulobacter crescentus shares sequence homology with choline dehydrogenase, yet other genes participating in this enzymatic reaction have not currently been identified. [Cellular processes, Adaptations to atypical conditions]
274888	Rv0697	1.10e-69	4	510	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	5.58e-45	365	505	1	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS15458.1|AA3_2	1.12e-200	2	512	14	532
CAK47101.1|AA3_2	2.25e-200	2	512	14	532
QMW36122.1|AA3_2	9.10e-200	2	512	14	532
QRD92907.1|AA3_2	9.10e-200	2	512	14	532
QMW48182.1|AA3_2	9.10e-200	2	512	14	532

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	2.23e-122	2	509	13	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	3.15e-122	2	509	13	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	8.88e-122	2	509	13	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
6ZH7_A	8.11e-51	2	509	7	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	8.11e-51	2	509	7	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	1.15e-121	2	509	13	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q6LGH5|BETA_PHOPR	1.96e-71	3	518	5	539	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q1QXE1|BETA1_CHRSD	9.58e-69	2	507	6	533	Oxygen-dependent choline dehydrogenase 1 OS=Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) OX=290398 GN=betA1 PE=3 SV=1
sp|Q9WWW2|ALKJ_PSEPU	1.57e-68	3	511	2	529	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q8NE62|CHDH_HUMAN	5.42e-68	2	509	40	571	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000002

TMHMM  Annotations     

There is no transmembrane helices in PTTG_28165-t43_1-p1.