CAZyme Information: PTTG_27335-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_27335-t43_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
581	ADAS02000051.1|CGC1	63755.36	5.6464

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000051.1:257074-259727(+)

Full Sequence      

MEEKFDYIVVGGGMAGLAVASRLSEKPELTVLVLEAGETGINNPAISVPGLMVTNLGSDI
DWNFCTVPQEGANQRKMSYPRGKVLGGSSAINFMMSSRAEAEDYDAIKRLGNPGWGWTEI
ERASKKSEKLIIPPTNSPYIFNPESHGRDGPVVNSFPKYIPPQFTSYFTACAAAGHVIQK
KDPFAGKLEGAYIYPSAIDDHGSRVTSATAYYFPNQSRTNLVVRTNCEVNKLILKNNGDN
SELQVLGVEYSSCGTPFRVLVTKEVIMSAGSIGTPAILERSGIGNEQILKSLNIPVTLNL
KGVGFNLSDHVFVIANYRLKPGHRTLEDLTKDPGYAAEQKLIYEQSGGGLFSHPTSIFNF
QSLRSIVSEDEMNEGLKLLKNCPSYLSPKQFEAVVDRIMNGVALEFSLVNTFFEPELPSD
RDTSYLTANVILQYPLSRGSSHIQSQDPGAAPLIDPKFLMHPFDAWLLAQGAKEIRKIMA
QDAHQDIILDEHYPGPSVQTNEQWEESVRRRALTSYHPCGTCSMLPQSESGVVDPQLRVY
GTQNLRVVDASILPVQLTSHPAMTVYAIAEKAAEMILNQSN

Enzyme Prediction     

No EC number prediction in PTTG_27335-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	578	1.3e-178	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.67e-109	1	578	4	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.17e-96	1	577	2	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	8.20e-44	435	572	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	4.87e-30	72	310	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.62e-23	2	577	53	577	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDI54770.1|AA3_2	3.21e-119	3	580	57	637
SAM84677.1|AA3_2	3.75e-118	2	580	57	639
KIS68002.1|AA3_2	1.07e-116	3	580	57	636
CBQ68668.1|AA3_2	1.65e-115	3	580	57	636
SJX64303.1|AA3_2	1.65e-115	3	580	57	636

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	9.93e-90	5	576	6	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	2.81e-81	5	576	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.55e-80	5	576	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	8.35e-72	1	576	2	582	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4H7U_A	4.05e-62	5	581	41	602	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	2.63e-97	1	577	10	617	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	1.87e-96	3	577	45	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	1.87e-96	3	577	45	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	2.59e-93	1	576	10	608	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	2.59e-93	1	576	10	608	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999869	0.000165

TMHMM  Annotations     

There is no transmembrane helices in PTTG_27335-t43_1-p1.