CAZyme Information: PTTG_26652-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_26652-t43_1-p1
• CAZy Family: GT33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	ADAS02000029.1|CGC1	41077.64	6.9671

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000029.1:5490-6998(+)

Full Sequence      

MQQTKTEILAQAAGHPGWTRLADDPVEYLLPGDVQRPDVAPRLQPVPEDASNDGCDAGLF
QGVLDGGCGHGGAAGLGVPSGGLHAPQPVIIGVCGETRITNKRQSWVTVIQVFEYYISHH
LTKAFESVFGGVTCLPGCFSMYRLKARRLNDGDWVPILTQPKICRKYSQSVVTTLHQQNL
LLLGGGTTLMICTFLARKMMFCPQAKCCTLVPDEFAVLGPRWINSTIHNLMELVRVPNLC
GTFCFSMQFFVFMELIGTIVLPIAITLTYSLVINSFLHPPKNFSDAIPLILGLPAVLILA
TSREVSYVFWMLIYLFVLPLYAFWHSVDDFSWGETRKVQGEVKNQGPDSGSKTTFDANTI
PHRRWDDWER

Enzyme Prediction     

EC	2.4.1.16:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	87	370	5e-123	0.5635673624288425

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367353	Chitin_synth_2	9.94e-140	88	370	230	526	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133033	Chitin_synth_C	6.92e-45	88	229	102	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
133045	CESA_like	6.88e-12	90	146	109	165	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	0.003	88	324	165	392	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABB70406.1|GT2	1.34e-154	87	364	702	996
CCA67565.1|GT2	2.18e-120	90	370	668	964
AAB71697.1|GT2	2.44e-119	89	370	658	955
AZQ26802.1|GT2	2.73e-119	83	370	640	942
QDK64615.1|GT2	2.73e-119	83	370	640	942

PDB Hits     

PTTG_26652-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13356|CHS1_CRYNH	1.19e-118	89	370	658	955	Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS1 PE=2 SV=2
sp|Q4P333|CHS7_USTMA	4.12e-114	87	370	653	952	Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS7 PE=3 SV=1
sp|J9VXM5|CHS3_CRYNH	2.18e-98	90	370	895	1193	Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS3 PE=1 SV=1
sp|O13394|CHS5_USTMA	8.35e-97	87	370	1001	1298	Chitin synthase 5 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS5 PE=3 SV=3
sp|Q01285|CHS4_NEUCR	1.64e-96	87	370	891	1188	Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-4 PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000017

TMHMM  Annotations     

Start	End
251	273
283	300
305	327