CAZyme Information: PTTG_26628-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_26628-t43_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
263	ADAS02000028.1|CGC2	29669.68	9.6798

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000028.1:269279-270248(+)

Full Sequence      

MRKTLYNVLILGFGNPMDALVLMYDRQDAGGKMYPLGGIYTVIKTKAPINCHKYGDQYCL
LGPLAYKSAPMEVEAIKPDTPEMRDSLQSMKDRGVKYLYRCWLIEGGPKVLLFDTGSMMS
CLDKWKNNLWNLAGIPAPPNNSKTNDTIVFGYLVSCFLGEFASRKTSKAIIGHFHKWLAG
LAIPLCRKRQINITTIFTTHTTLLGCYLCAGSVDFYNNIQYFDVNHKAGKRGIYHRYCVK
WASTHCANEFPRRPAVRTALSAK

Enzyme Prediction     

EC	2.4.1.11:48

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340824	GT3_GSY2-like	4.56e-105	37	250	16	230	glycogen synthase GSY2 and similar proteins. Glycogen synthase, which is most closely related to the GT3 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis. GSY2, the member of this family in S. cerevisiae, has been shown to possess glycogen synthase activity.
399009	Glycogen_syn	8.48e-93	36	250	10	225	Glycogen synthase. This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3. Glycogen synthase (GS) is the enzyme responsible for the synthesis of -1,4-linked glucose chains in glycogen. It is the rate limiting enzyme in the synthesis of the polysaccharide, and its activity is highly regulated through phosphorylation at multiple sites and also by allosteric effectors, mainly glucose 6-phosphate (G6P).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGV14661.1|GT3	2.74e-108	36	250	21	235
AFR97593.2|GT3	2.74e-108	36	250	21	235
AUB27626.1|GT3	2.74e-108	36	250	21	235
UOH84093.1|GT3	2.74e-108	36	250	21	235
AAW45795.1|GT3	1.08e-107	36	250	21	235

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6U77_A	1.03e-75	36	250	21	244	yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C],6U77_B yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C],6U77_C yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C],6U77_D yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C]
5UW0_A	1.34e-75	36	250	41	264	Chain A, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5UW0_B Chain B, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5UW0_C Chain C, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5UW0_D Chain D, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5UW1_A Activated state yGsy2p in complex with UDP-galactose [Saccharomyces cerevisiae S288C],5UW1_B Activated state yGsy2p in complex with UDP-galactose [Saccharomyces cerevisiae S288C],5UW1_C Activated state yGsy2p in complex with UDP-galactose [Saccharomyces cerevisiae S288C],5UW1_D Activated state yGsy2p in complex with UDP-galactose [Saccharomyces cerevisiae S288C],5UW4_A Chain A, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5UW4_B Chain B, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5UW4_C Chain C, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5UW4_D Chain D, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5VNC_A Chain A, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5VNC_B Chain B, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5VNC_C Chain C, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5VNC_D Chain D, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C]
5UX7_A	1.34e-75	36	250	41	264	Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_B Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_C Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_D Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C]
4KQ1_A	1.44e-75	36	250	40	263	Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ1_B Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ1_C Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ1_D Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ2_A Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO],4KQ2_B Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO],4KQ2_C Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO],4KQ2_D Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO]
4KQM_A	1.44e-75	36	250	40	263	Crystal structure of yeast glycogen synthase E169Q mutant in complex with glucose and UDP [Saccharomyces cerevisiae FostersO],4KQM_B Crystal structure of yeast glycogen synthase E169Q mutant in complex with glucose and UDP [Saccharomyces cerevisiae FostersO],4KQM_C Crystal structure of yeast glycogen synthase E169Q mutant in complex with glucose and UDP [Saccharomyces cerevisiae FostersO],4KQM_D Crystal structure of yeast glycogen synthase E169Q mutant in complex with glucose and UDP [Saccharomyces cerevisiae FostersO]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O93869|GYS_NEUCR	1.48e-93	36	250	27	241	Glycogen [starch] synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gsy-1 PE=2 SV=2
sp|P23337|GYS1_YEAST	2.10e-80	36	263	21	256	Glycogen [starch] synthase isoform 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GSY1 PE=1 SV=3
sp|P27472|GYS2_YEAST	5.28e-75	36	250	21	244	Glycogen [starch] synthase isoform 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GSY2 PE=1 SV=3
sp|Q9Z1E4|GYS1_MOUSE	7.66e-72	36	250	40	255	Glycogen [starch] synthase, muscle OS=Mus musculus OX=10090 GN=Gys1 PE=1 SV=2
sp|A2RRU1|GYS1_RAT	7.66e-72	36	250	40	255	Glycogen [starch] synthase, muscle OS=Rattus norvegicus OX=10116 GN=Gys1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.970658	0.029369

TMHMM  Annotations     

There is no transmembrane helices in PTTG_26628-t43_1-p1.