CAZyme Information: PTTG_26323-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_26323-t43_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	ADAS02000019.1|CGC1	41103.41	10.0336

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000019.1:461783-464114(-)

Full Sequence      

MQVSQQLNPTGSCHCQVNAGSPAVVLLCGQKLKDQILTMRNGVGKLTLLRLGLKQARRII
AINHNPILKNILVAAFFSLSAWAQSSPPAGALIVRQTNSGTSGEEFTTISSAVAALSRLT
GPQTIFIYPGTYTEQVKISYPYSLSLQGYSSNPTSSASNQVTVRAAVSAAQAGSNSKSAT
IWAYSPGIRISNLNVINSFGTGTDTQALALAATGRRQVFKHCVFSSFQDTVSIEGTSYFF
ESRIEGAVDFVFGSGSAWFEAVILAIKPASSPVITAQRNSPGGITAFVFNRAQVISAGAS
AGSAYLGRPWSEDATVIFQFCSLSDVINPAGWRIWAPSQPNTARAKFQEYRNSGPGASTR
ARQLGTQMSSQVEISSILGSDYSTWAQ

Enzyme Prediction     

EC	3.1.1.11:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	102	363	1.2e-64	0.9027777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215357	PLN02665	1.51e-33	94	385	72	359	pectinesterase family protein
178051	PLN02432	1.19e-31	91	382	10	285	putative pectinesterase
178113	PLN02497	1.23e-29	67	362	6	299	probable pectinesterase
178372	PLN02773	1.79e-28	86	364	1	282	pectinesterase
395871	Pectinesterase	3.08e-28	93	362	3	271	Pectinesterase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL40912.1|CE8	8.87e-81	87	380	37	332
ALL41233.1|CE8	3.46e-63	87	380	37	304
ARB08121.1|CE8	9.24e-62	67	385	2	324
QKX54343.1|CE8	1.31e-60	76	385	11	321
AFO55205.1|CE8	4.01e-60	67	385	3	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	2.89e-45	83	385	2	294	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	4.05e-45	83	385	2	294	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	1.95e-15	105	362	18	278	Pectin methylesterase from Carrot [Daucus carota]
4PMH_A	1.87e-12	178	357	149	366	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]
3UW0_A	1.45e-10	103	367	41	347	Pectin methylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	3.60e-53	67	385	1	325	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	2.13e-51	67	385	1	324	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	4.88e-46	84	385	28	319	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	4.88e-46	84	385	28	319	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	2.64e-45	84	385	28	319	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PTTG_26323-t43_1-p1.