CAZyme Information: PTTG_26290-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_26290-t43_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
553		61592.46	6.1746

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000018.1:633397-636393(+)

Full Sequence      

MLSNPAKLVLFGCMLQISSVVCQAPPKLQKSGLKQSDQDKQRAEEVKTAFAGAFDDYMKF
GFPGDEVRPLTKTARNTRNGWSATLVDSLDTHLVMNLQDRFTQGVADTLKIDFSKSNTED
GVSIFESTIRYIAGILSAYELSGATNAALLDQARKLGDRLLVCWQDDQQNLPFPFLDFAT
NKPVVRDFISAASAGSLIMEFDRLSFYTRQPKYLQYATKAVQTIIRTPSSLPGLPGLVFG
VKNQTILSDFSTWGSGTDSYMEYLLKYGMLIDNKDPSYYQTWQQAVQSSIQKLIQVSPVG
NLTYLGGYSSSSKTSDYEFSHLACFTGGNWLLGGKVFQDNQLFDYGLKLVATCMESYKRT
ATGLGPEIFRFLGRNGETNDEKPSAQDMEFFRTNGFYITNSAYHLRPEVIESAFYGWRLT
GDRQYQEFVWQAFKSLQKYCKAPASFSDIENVNSASNPKPSDASESFLYAETFKYIYLTF
SDPELLSLDQYVFNTEAHPFRYQRTQDASNSTGPSTPMAKTGSKRGSAPADAGGRFSAGL
LLICLLSTFVGVL

Enzyme Prediction     

No EC number prediction in PTTG_26290-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	49	501	5.3e-122	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	6.76e-158	49	501	1	452	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	4.37e-118	36	506	66	522	glycoside hydrolase family 47 protein; Provisional
224250	YyaL	7.66e-07	70	234	420	581	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV84818.1|GH47	3.78e-129	28	499	20	480
QRV98862.1|GH47	3.78e-129	28	499	20	480
QRW04952.1|GH47	3.98e-125	28	499	20	505
QRW13417.1|GH47	6.21e-125	28	499	20	481
QRV76191.1|GH47	3.01e-124	50	499	2	455

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	8.59e-84	42	504	5	475	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	2.27e-83	42	504	40	510	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
1HCU_A	6.74e-79	34	500	7	490	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
1NXC_A	1.27e-58	40	506	18	469	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
5KKB_A	3.91e-58	40	500	20	465	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CP08|MNS1B_ASPCL	5.63e-92	35	501	28	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1
sp|A2QAS2|MNS1B_ASPNC	4.61e-91	36	505	36	513	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|Q2ULB2|MNS1B_ASPOR	2.34e-90	36	501	34	507	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1
sp|B8N417|MNS1B_ASPFN	2.34e-90	36	501	34	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2
sp|Q12563|MNS1B_ASPPH	9.94e-90	36	505	36	513	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000273	0.999699	CS pos: 22-23. Pr: 0.9720

TMHMM  Annotations     

There is no transmembrane helices in PTTG_26290-t43_1-p1.