CAZyme Information: PTTG_25964-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_25964-t43_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein, variant 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479		53998.97	8.5696

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000011.1:1187994-1189669(+)

Full Sequence      

MRPLRQLACSLTSLFNAYAGVRTFSNSLETALTASALAYWPWNAHEIPHSWANLSLSILL
IALSVIVRPSAILFWSVLGYTLLKKSTGEARMDVMALVAVLGVTSALACLLIDSSFYGLV
TFTPLNFIRQNVLNDLSTFYGVNRWHFYFTQAFTFVNFSMFPTVILGMLSLITPQNVHES
PGQLDRLRSARVAVLGTMLGLSLLRHKEFRFIAPLVPLFNCFAARAMVNNYIKDRLARPA
SSPADISRLERILSARPLGFILRSSVAFAAAVYLLGFHYRAQIAVIDYLRQLPDLELKSV
GFLMPCHSTPWQSHLHKPHLAPNGTQERLWMLTCEPPLISFRNSSSTEADGAANSTAHAN
QTEDTTEERERKEQKAESKQLDDPGEYEDEAAEFYRDPPGFLTARFPETVDKGYPATDKS
TGRYQWPSHLVLFDALWTLHPVRSLLQDRGYRVVWNMTNGWWHDDPQRRAGNVIVLRSS

Enzyme Prediction     

No EC number prediction in PTTG_25964-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	7	316	9.3e-66	0.7146529562982005

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	3.35e-45	7	316	115	414	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
215437	PLN02816	1.62e-28	7	317	153	452	mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR45799.1|GT22	5.45e-62	7	470	133	559
ANB11947.1|GT22	8.82e-58	7	470	126	514
QLQ78012.1|GT22	5.79e-55	10	477	171	579
CCA68858.1|GT22	7.13e-55	7	477	119	554
AXA51909.1|GT22	2.62e-54	11	476	120	541

PDB Hits     

PTTG_25964-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6BH65|GPI10_DEBHA	4.01e-51	7	475	157	545	GPI mannosyltransferase 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI10 PE=3 SV=2
sp|Q6CAB8|GPI10_YARLI	7.30e-49	7	475	130	507	GPI mannosyltransferase 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI10 PE=3 SV=1
sp|Q75BG9|GPI10_ASHGO	6.60e-45	3	479	168	592	GPI mannosyltransferase 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=GPI10 PE=3 SV=1
sp|Q2UH15|GPI10_ASPOR	5.06e-42	7	475	164	626	GPI mannosyltransferase 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi10 PE=3 SV=1
sp|P30777|GPI10_YEAST	2.98e-40	7	475	191	600	GPI mannosyltransferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI10 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.985919	0.014065

TMHMM  Annotations     

Start	End
56	78
98	120
153	172
187	204
211	228
259	281