CAZyme Information: PTTG_25220-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_25220-t43_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
524		56579.61	7.1570

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000002.1:533982-536296(+)

Full Sequence      

MLAHFSGGYKSRAMNQDRSRLVKLAITACVVPAYLGGYLVTADTASLRSKFSTLGIDAVF
PGDSDYDKFAASFNRRLSYKPAAIAFPNNTDAVASAVKLGVQEKLRLSARSGGHSYAAYG
LSGTDGALVIDLQRMKQVSVDSSNGEAVIGTGIRLGDIALALNDQGGRALPHGLCPLVGL
GGHAAFGGYGFTSRQWGLTLDKIISHEVVLGDGSIVTASKTSNPDLFWALRGSGASYGIM
TAIRFQTETAPREATDFGIQWNLNEEDFGQTLIKLQTFCMSDVPAQLGMTVNLRKSKESG
KLLFDFAGAWYGEASAFAGVVQPFLSQMPPPTHNSVKTTDWITSLSRILGGQALSTANVD
LAEEHDTFYAKSLTTPASAPMSNSSIAAFSKVLATQGLQSKTDWFVQFELYGGKNSAITA
VRPDETAFAQRSILFTIQFYSRSSNYSPPYPAEGFTLLDSMVDSIVANNPSGWGYGAYAN
YVDERLSPSQWKSQYYNNHYERLTQIKGVYDPQNVFSYPQSITT

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	69	522	1.5e-88	0.9934497816593887

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	2.87e-31	81	219	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	8.24e-31	52	255	4	211	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	5.48e-12	477	522	1	44	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	4.58e-09	24	251	5	242	cytokinin dehydrogenase
273751	FAD_lactone_ox	7.24e-08	78	246	12	177	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW15212.1|AA7	1.59e-117	43	522	27	489
QRV86657.1|AA7	1.59e-117	43	522	27	489
QRW00715.1|AA7	1.00e-115	43	522	27	489
QRW27390.1|AA7	8.21e-115	59	522	44	490
CDR44461.1|AA7	3.86e-110	24	522	10	513

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ZR6_A	3.79e-93	42	522	4	476	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
3HSU_A	8.24e-92	42	522	4	476	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]
6Y0R_AAA	6.65e-91	62	522	42	488	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
5K8E_A	6.49e-85	42	522	22	492	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
3RJ8_A	2.19e-82	46	522	2	469	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6PW77|GOOX_SARSR	3.46e-92	66	522	47	495	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1
sp|I1S2K2|CHITO_GIBZE	3.42e-90	62	522	42	488	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|P9WEY2|DPMAF_METAN	3.02e-85	38	522	17	489	FAD-linked oxidoreductase dpmaF OS=Metarhizium anisopliae OX=5530 GN=dpmaF PE=1 SV=1
sp|E9F5F1|SUBF_METRA	4.25e-85	38	522	17	489	FAD-linked oxidoreductase subF OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=subF PE=3 SV=1
sp|G2QG48|XYLO_MYCTT	3.34e-84	42	522	22	492	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.947128	0.052901

TMHMM  Annotations     

Start	End
20	42