CAZyme Information: PTTG_25217-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_25217-t43_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
199		21492.18	8.3495

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000002.1:328860-329871(-)

Full Sequence      

MIASGGMQQVEANTGITISNNLFSGKTKWSQRCSNRHYWTVLLSGADDQITMARNCIDST
SGRTPKTGGSGNPKVLLHYYNNVHTNILGETFEIGSGSKVLAEGNLFENVKIQNPSDIET
QDAGHSYVPMKPEEAARCTSILGRPCVTNLLRKSSPYKFALDSQILDNFKTFPAVARANV
SPASSIQREVAGQCGAGHI

Enzyme Prediction     

No EC number prediction in PTTG_25217-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	9	109	3.2e-33	0.5240641711229946

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	5.22e-15	14	111	102	190	Amb_all domain.
366158	Pec_lyase_C	4.44e-06	11	107	122	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW23643.1|PL1_4	3.57e-33	11	199	195	379
QRW21460.1|PL1_4	9.58e-33	12	199	196	378
QRW23637.1|PL1_4	9.91e-33	11	199	196	380
ATZ48538.1|PL1_4	2.06e-32	16	199	204	385
CCD51274.1|PL1_4	2.06e-32	16	199	204	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	2.98e-25	12	169	185	333	Pectin Lyase B [Aspergillus niger]
1IDK_A	7.91e-24	12	199	185	359	Pectin Lyase A [Aspergillus niger]
1IDJ_A	4.05e-23	12	199	185	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJA7|PELF_ASPOR	5.05e-32	11	154	205	340	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|B8N316|PELF_ASPFN	5.05e-32	11	154	205	340	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q0CZD4|PELF2_ASPTN	3.97e-27	11	162	204	346	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q5BA61|PELB_EMENI	7.39e-27	12	193	204	376	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|Q5B3J8|PELF_EMENI	1.76e-26	11	199	200	378	Probable pectin lyase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999380	0.000679

TMHMM  Annotations     

There is no transmembrane helices in PTTG_25217-t43_1-p1.