CAZyme Information: PTTG_12625-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_12625-t43_1-p1
• CAZy Family: GT21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323		36022.12	9.4654

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000170.1:1578-3170(-)

Full Sequence      

MSQTIYSATRASLLLLVVLSALVAPNFSKIILDYRIPLTAKVADLTVKTTALGKLTKDTI
QGTNSLAEAYEFLKPATGKFQQMVLKINDKSIFQDQKGFRRNDIVPVYDPVSIEKDIKTY
HHSFIVKKDGKLDLRHGYLLASVEFAKADGTHIYDIHLGTPFKSDNTAGTKSPDADFFRV
RDINFKTLFDVKMIPDTIFNFAIEVDWKQNKLSVYHSTGNDKLKQVVKPTAFVATNEKAK
NAAGTGEWHIQMIKDPLPNKADPEKERSDVPHKGIQESNIDESIIHFRNFIEDKTTTDPD
GPDAIATGGTAAIDAARQKTRKP

Enzyme Prediction     

No EC number prediction in PTTG_12625-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	30	297	1.5e-35	0.9725490196078431

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	1.14e-93	30	297	1	251	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL40783.1|GH131	1.06e-74	29	307	25	311
QRV95300.1|GH131	8.70e-24	81	292	83	295
QRW09714.1|GH131	8.42e-23	81	292	83	295
QRV80910.1|GH131	8.42e-23	81	292	83	295
QRW22550.1|GH131	2.84e-21	74	295	73	296

PDB Hits     

PTTG_12625-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

PTTG_12625-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.179743	0.820215	CS pos: 28-29. Pr: 0.7354

TMHMM  Annotations     

Start	End
13	32