CAZyme Information: PTTG_12354-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_12354-t43_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		40686.84	5.3365

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000394.1:9383-11351(-)

Full Sequence      

MGISGYGTRSGFFSFVIPLLLIIAKASCMVDFPSEPSETEESFQPSWTNYSAFVVFGDSY
SDNGHPRSPEDQPSFAAKPAVGGRFCDGPVWDEYLAQNLSNSADSNITFLNYAYNGAHIN
NKLSNRAAKPVPDTAAQIHTYLTDLAQYVQHPISRKVFEGRILHALWIGINPILAIWRFA
FSANQSLQSDNLLTPEVAEKLDAQVKEFSRQLSYLLNNRSLAKFQTDYMVMTIPPLTNTA
LAISESSQAAKGDVTLAQQHVELLAQITDHFNSKLVAAVQEMKPRFSIHDSRITIFDTVD
FWNDVRSAPEKYGIRSLGSCFTDPNKPPCNKPDLYMYWDILHPSSILHSNLSNAIMQFLN
DLDE

Enzyme Prediction     

No EC number prediction in PTTG_12354-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	53	354	9e-28	0.9887640449438202

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	1.57e-41	53	358	2	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
225780	COG3240	5.32e-17	44	359	23	333	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238875	SGNH_plant_lipase_like	1.69e-15	52	344	2	300	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238883	Triacylglycerol_lipase_like	2.72e-13	50	353	1	275	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
395531	Lipase_GDSL	4.88e-04	54	355	2	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
URD49815.1|CE0	4.24e-13	48	359	31	290
USQ14553.1|CE0	5.27e-12	54	361	25	302
BDA67938.1|CE16	2.83e-11	55	360	38	285
ARO87639.1|CE0	7.77e-11	50	354	27	319
QMS90382.1|CE0	8.80e-11	49	348	25	283

PDB Hits     

PTTG_12354-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9C7N5|GDL14_ARATH	1.17e-08	53	352	33	341	GDSL esterase/lipase At1g29660 OS=Arabidopsis thaliana OX=3702 GN=At1g29660 PE=1 SV=1
sp|Q99289|HLT_VIBPA	7.30e-06	40	364	136	415	Thermolabile hemolysin OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=VPA0226 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001479	0.998480	CS pos: 28-29. Pr: 0.9358

TMHMM  Annotations     

There is no transmembrane helices in PTTG_12354-t43_1-p1.