CAZyme Information: PTTG_12138-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_12138-t43_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
567		62100.86	7.6465

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000027.1:647024-649541(+)

Full Sequence      

MSHFKPFTIKFHLEYLEDGLLPGHSYFLAHATLITDGLVATRPATQLDSCSSPGKGDATT
RSHGSFRECIRSTLGASESFSSKAVFPEDPAYPVSTLTYNVAIQHHASAVVYAASAEDVS
EAVKCAAEFRVPVVARTGGHSYASFSSSPHGLIIDVTNLKGFSFETDHVGQVAEKVTFGA
GLRLGDLDMELQDHERAVPHGVYPYIGVSGHATCGGFGTASRMWGLFSDLVVELEVVSAN
GTIVKASEKTNADLFFAMRGAGPSFGIITALTMRTQEAPRSVILFEIGYEFPNPDSAAAT
LNHFQSWGRKSAPSQLGIRWSVKLQHEPNDPKKIGLAWKLQGSFFGRTARFNRTINRLTK
DFSVKGEFLSIQRLDWLESVRALGGNQPLSSEGIDPSNTNVSYYAKSFVVRDANPLTYSQ
WTSVMKKLYGIASAVKRSERLDWFLEIDLVGGRYQGQETGVRGSGSTTSSFGPRDALLLF
QMAGYGPKGASLEHGRLMEPTKRTSQQIYDALGGGRKELTGFNCYVDSEFSAERAHREYF
GDKNTAILRELKNVWDPARVFNHPHSF

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	97	312	1e-69	0.45414847161572053

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.57e-25	117	247	11	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	2.31e-25	117	316	42	244	FAD/FMN-containing dehydrogenase [Energy production and conversion].
178402	PLN02805	1.18e-12	117	283	144	313	D-lactate dehydrogenase [cytochrome]
215242	PLN02441	1.53e-09	117	282	75	245	cytokinin dehydrogenase
273751	FAD_lactone_ox	1.23e-07	117	274	25	177	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC19098.1|AA7	4.46e-66	67	566	10	467
UNI23960.1|AA7	1.03e-62	86	566	26	468
RDX44700.1|AA7|1.1.3.-	1.75e-62	74	567	36	510
BAI44126.1|AA7|CBM18	1.77e-62	84	566	252	715
QBZ61916.1|AA7|CBM18	4.70e-62	84	566	252	715

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Y0R_AAA	4.74e-45	99	566	53	487	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
6YJO_A	4.43e-40	87	566	48	500	Chain A, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1]
5K8E_A	2.88e-38	99	566	53	491	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
6EO5_A	3.30e-36	82	566	23	467	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
6EO4_A	4.50e-36	82	566	23	467	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1S2K2|CHITO_GIBZE	2.44e-44	99	566	53	487	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|P9WEY2|DPMAF_METAN	6.19e-44	57	566	20	488	FAD-linked oxidoreductase dpmaF OS=Metarhizium anisopliae OX=5530 GN=dpmaF PE=1 SV=1
sp|E9F5F1|SUBF_METRA	8.52e-44	57	566	20	488	FAD-linked oxidoreductase subF OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=subF PE=3 SV=1
sp|B6HNK6|SORD_PENRW	1.08e-42	66	566	7	466	FAD-linked oxidoreductase sorD OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=sorD PE=3 SV=1
sp|G2QG48|XYLO_MYCTT	1.48e-37	99	566	53	491	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PTTG_12138-t43_1-p1.