CAZyme Information: PTTG_12077-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_12077-t43_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
998		112308.78	5.5365

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000017.1:487392-490952(+)

Full Sequence      

PAGSVKRGDFKTCEQAGFCKRLRGRSDRARSPEYAAGWKSPYVLEALPEWAEETNTLHVR
LANELVPGIAFGLNLTVLAESEGSLRIKLDELAGLRQRYNEADKWTLLGQPKLLTSKHIS
IDIGQHQTLLTWPGNIAREYQCRLHYRPFKIDLLRDGQPHIILNQRGLFTMEHFRAKPQT
NDEGLLIQEPADPAVLSTPDDLYPGFKDTSEEGMWEESFGGRTDTKPKGPESLALDITFP
GYSHVYGIPEHASPLSLKTTRGSPEGTSPAAYTDPYRLWNLDVFEYEADSEMALYGAIPL
MKAHRAGSTVGVFWLNAAETWVDVEKAETSPEVVEAWKGRTEASAAGADADEGPTGTSTQ
TYWMSESGILDLFVFLGPSSAEIFASFAALVGTTLLPPYFSIAYHQCRWNYVSQDDLLSV
LHNFDTFDIPLDVIWLDIEYAEEHKYFIWDKRHFPEPLKMINQLEATGRKLVTIVDPHIK
RTQDLYVYKEAVELNVLSKLPDGSEYEGWCWTGSSSWVDYFDPRSWDWWAGLFKFDKYKE
STINVHNWLDMNEPSVFNAPEITMPRDNIHHGGWEHRDLHNLNGMASHNQSARGLRERTD
PPMRGFVLSRSFFAGSQRYGAIWQGDNMGTWPHLAVSIPMLLSNSIAGMAFNGADVGGFF
GNPSPELLVRWYQAGAFFPFFRAHAHIDTKRREPYLFDEPVRGQIVDMIKLRYSLLPSWY
TLFFENTLTGAPMTTPQYVMFPKDEAGFAVDDQFYLGSTGLLVKPITQEGLTSTDVYIAD
DQPYYNYFTSDMFLVDQGKHASRTFTFPAPLGTVPLFQRGGYIVTRRDLIRRAAPLMWKD
PITLVVALDKEGHATGTLYLDDGESFNHERGQFLYKRFSIKKENSGSFTLSSSDAVAQTL
KSTHEALRSTLAQYQPDNDWIKKISSVDIDKVIILGLPARPTCVKVSGRKDGLPYEYSTG
LASTVTSAKMTGLGKRASVLEIKNAAAKVVDDWSIEVG

Enzyme Prediction     

EC	3.2.1.20:27	3.2.1.84:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	373	824	4.1e-140	0.9953161592505855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269889	GH31_GANC_GANAB_alpha	0.0	392	865	1	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
395838	Glyco_hydro_31	0.0	373	824	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
224418	YicI	5.66e-165	229	887	139	731	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269890	GH31_glucosidase_II_MalA	3.17e-136	392	730	1	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
269888	GH31_MGAM_SI_GAA	3.63e-103	392	725	1	365	maltase-glucoamylase, sucrase-isomaltase, lysosomal acid alpha-glucosidase. This subgroup includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase. MGAM is one of the two enzymes responsible for catalyzing the last glucose-releasing step in starch digestion. SI is implicated in the digestion of dietary starch and major disaccharides such as sucrose and isomaltose, while GAA degrades glycogen in the lysosome, cleaving both alpha-1,4 and alpha-1,6 glucosidic linkages. MGAM and SI are anchored to small-intestinal brush-border epithelial cells. The absence of SI from the brush border membrane or its malfunction is associated with malabsorption disorders such as congenital sucrase-isomaltase deficiency (CSID). The domain architectures of MGAM and SI include two tandem GH31 catalytic domains, an N-terminal domain found near the membrane-bound end, and a C-terminal luminal domain. Both of the tandem GH31 domains of MGAM and SI are included in this family. The domain architecture of GAA includes an N-terminal TFF (trefoil factor family) domain in addition to the GH31 catalytic domain. Deficient GAA expression causes Pompe disease, an autosomal recessive genetic disorder also known as glycogen storage disease type II (GSDII).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR40638.1|GH31	0.0	4	995	38	999
CCA68722.1|GH31	0.0	4	997	16	967
QRV98044.1|GH31	0.0	5	997	20	975
CED84350.1|GH31	0.0	1	995	19	982
ADV19341.1|GH31	0.0	4	998	23	956

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DKX_A	4.06e-294	5	976	5	941	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DKY_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5JQP_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
5DKZ_A	6.53e-293	5	976	5	941	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DL0_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
5IEF_A	3.17e-241	5	893	1	844	Murine endoplasmic reticulum alpha-glucosidase II with N-butyl-1-deoxynojirimycin [Mus musculus]
5IEG_A	3.27e-241	5	893	1	844	Murine endoplasmic reticulum alpha-glucosidase II with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
7KRY_A	1.71e-240	5	893	32	875	Chain A, Neutral alpha-glucosidase AB [Mus musculus],7KRY_C Chain C, Neutral alpha-glucosidase AB [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9US55|GLU2A_SCHPO	3.38e-254	7	881	28	850	Glucosidase 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gls2 PE=1 SV=1
sp|Q8BHN3|GANAB_MOUSE	3.11e-240	4	893	32	876	Neutral alpha-glucosidase AB OS=Mus musculus OX=10090 GN=Ganab PE=1 SV=1
sp|Q94502|GANAB_DICDI	2.39e-239	4	962	23	923	Neutral alpha-glucosidase AB OS=Dictyostelium discoideum OX=44689 GN=modA PE=3 SV=1
sp|P79403|GANAB_PIG	5.53e-238	4	893	32	876	Neutral alpha-glucosidase AB OS=Sus scrofa OX=9823 GN=GANAB PE=1 SV=1
sp|Q4R4N7|GANAB_MACFA	2.47e-236	4	893	32	876	Neutral alpha-glucosidase AB OS=Macaca fascicularis OX=9541 GN=GANAB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PTTG_12077-t43_1-p1.