CAZyme Information: PTTG_12075-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_12075-t43_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
606		67715.93	8.7941

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000017.1:525630-528105(-)

Full Sequence      

LPNKHFLLRTILPKMLTMIPASSLVILLTVIINHQAQGSSQPPKKPDSISSGSGALTDND
VSGTYFGWSTWSLQAYKGKGYGYDWLTETNIKAHADILSKEFSQLGYTRVNLDSGWQDAQ
LDEFGRTVLNHTTFPSGIGNLSAYLAQKQLKLGLYYLPGIDARAVKNKSPVMATKYTADQ
IIQCPDKEALGCNRTIANAFNAGLALNYSHPGAQMYINSVVDGLYRWGVSFVKLDGIVPG
SSVDPPEWWKYNATADLMAWRKAINDLYEQKWQKQGRERIWLGASWKIPTSAGSTMEKYV
NSFRIEQDIEAYSETQMTTFDRVIRNAKTAALWSSADANRKWKGARDLDSILISDMTLAE
SRTMVTLWALFGSVFYLGDDLTKLPESRKALVKNPEVLKLASIASANPARLDGFDPSLSH
PHPQTAVLQSVNQLGSNFAPEVQEESAQECEELAEKRRIVVEYGTHQKVDNLDSFYKSCL
KARKGEELIGLQAMSLTEGVKHDPWSLQYWVLEQDQGEIYVAVVNAGRQKRTDRPAKVEI
SLSKLKTLQNSPRIKQISGMQYTVRDLWKNKNMRSVSFQDKIDSTLETHGSILLNFSPIH
PAISSS

Enzyme Prediction     

No EC number prediction in PTTG_12075-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	224	409	6.6e-24	0.6855895196506551

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269893	GH27	1.47e-62	67	398	4	266	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
374582	Melibiase_2	1.19e-13	86	398	26	279	Alpha galactosidase A.
177874	PLN02229	2.88e-13	18	400	1	322	alpha-galactosidase
178770	PLN03231	3.86e-13	83	407	11	352	putative alpha-galactosidase; Provisional
166449	PLN02808	4.56e-13	67	398	35	290	alpha-galactosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCM93998.1|GH27	2.66e-58	53	398	23	354
BCL77684.1|CBM35|GH27	9.70e-55	65	410	57	388
QIZ00458.1|CBM35|GH27	4.62e-49	13	410	22	394
QNE35833.1|GH27	1.86e-48	65	398	103	414
UOZ10267.1|CBM35|GH27	2.02e-48	65	398	42	362

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CC1_A	1.41e-10	67	400	15	340	Chain A, Putative alpha-N-acetylgalactosaminidase [Halalkalibacterium halodurans C-125],3CC1_B Chain B, Putative alpha-N-acetylgalactosaminidase [Halalkalibacterium halodurans C-125]
3A21_A	2.00e-10	67	398	15	289	Crystal Structure of Streptomyces avermitilis beta-L-Arabinopyranosidase [Streptomyces avermitilis],3A21_B Crystal Structure of Streptomyces avermitilis beta-L-Arabinopyranosidase [Streptomyces avermitilis],3A22_A Crystal Structure of beta-L-Arabinopyranosidase complexed with L-arabinose [Streptomyces avermitilis],3A22_B Crystal Structure of beta-L-Arabinopyranosidase complexed with L-arabinose [Streptomyces avermitilis],3A23_A Crystal Structure of beta-L-Arabinopyranosidase complexed with D-galactose [Streptomyces avermitilis],3A23_B Crystal Structure of beta-L-Arabinopyranosidase complexed with D-galactose [Streptomyces avermitilis]
3A5V_A	5.10e-10	67	409	12	302	Crystal structure of alpha-galactosidase I from Mortierella vinacea [Umbelopsis vinacea]
1UAS_A	7.70e-10	67	398	12	267	Chain A, alpha-galactosidase [Oryza sativa]
3LX9_A	5.02e-09	97	400	45	288	Chain A, Alpha-galactosidase A [Homo sapiens],3LX9_B Chain B, Alpha-galactosidase A [Homo sapiens],3LXA_A Chain A, Alpha-galactosidase A [Homo sapiens],3LXA_B Chain B, Alpha-galactosidase A [Homo sapiens],3LXB_A Chain A, Alpha-galactosidase A [Homo sapiens],3LXB_B Chain B, Alpha-galactosidase A [Homo sapiens],3LXC_A Chain A, Alpha-galactosidase A [Homo sapiens],3LXC_B Chain B, Alpha-galactosidase A [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92451|AGAL3_HYPJE	1.24e-15	55	326	174	433	Alpha-galactosidase 3 OS=Hypocrea jecorina OX=51453 GN=agl3 PE=1 SV=1
sp|C8VJZ7|AGAL8_EMENI	1.50e-14	67	408	84	414	Putative alpha-galactosidase 8 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agl8 PE=5 SV=2
sp|Q9URZ0|AGAL_SCHPO	1.02e-10	59	411	20	331	Alpha-galactosidase mel1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mel1 PE=3 SV=1
sp|Q8RX86|AGAL2_ARATH	1.15e-10	67	398	43	298	Alpha-galactosidase 2 OS=Arabidopsis thaliana OX=3702 GN=AGAL2 PE=1 SV=1
sp|Q8VXZ7|AGAL3_ARATH	5.55e-10	67	398	76	330	Alpha-galactosidase 3 OS=Arabidopsis thaliana OX=3702 GN=AGAL3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000003

TMHMM  Annotations     

There is no transmembrane helices in PTTG_12075-t43_1-p1.