CAZyme Information: PTTG_11895-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_11895-t43_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
571	ADAS02000092.1|CGC1	63443.01	8.5218

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000092.1:101526-104275(-)

Full Sequence      

MQLKAKSWSDGYQPFSRIQWIGITVLFLTTGLTTQSPTDLMRRNPPPQPAGPKPAMGWNS
FWPLGCGKHVNQDELRKHADLLVGTGLTAAGYSTLIVECGWEDWPDKDGSPTIKQRTFKD
GLKPFTDYLNSKGLHLGFGTWAGPQLCRRGRHKKFHGGDPPSDLKRYVGKLVEWGVGYLS
HRPCDLASPDRLQHPDQASPLNSRYVQMEDAIRDSKVKLFYATGQWGASPEVKNQPRANS
WRISYESRDNWNSFIRTLNALVPNAPNTRPGSFADLGFLQLGKNKQPTLEMITQYAFWAA
AKSPLIFSTDLSKLHADFIEFLKNPGPIAINQDELGKSITFKRRYADDKDIWSGPLSDGS
TVAVIINWEYDTSKKQINLADMGFSSAHVYDIWHGKDLGAVNSTYNATVGGHGCLFLKLN
DTKPAPKPQFKRFPAETADLMGSARLKDVTPKIKAVSLISPNGGGGARWTIPGQMQGDVL
VSFDYINAQWAPGDNDYSKLNFKRVVITVNDEKKVIADFPVSGLLWEEVYEGFLVSLPLM
PGDNKVLVEGVDEWAPDFVALSVEQKPEQAG

Enzyme Prediction     

EC	3.2.1.22:58	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	171	399	9.8e-40	0.9301310043668122

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269893	GH27	4.79e-52	55	333	2	271	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
166449	PLN02808	9.89e-49	25	414	3	378	alpha-galactosidase
178295	PLN02692	3.73e-44	38	424	40	410	alpha-galactosidase
177874	PLN02229	7.09e-35	56	414	65	412	alpha-galactosidase
374582	Melibiase_2	7.62e-17	56	333	4	284	Alpha galactosidase A.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV97448.1|CBM35|GH27	6.11e-104	54	563	29	544
QRW24696.1|CBM35|GH27	7.54e-103	54	563	27	536
QRW11978.1|CBM35|GH27	1.33e-102	54	563	29	544
QRV83253.1|CBM35|GH27	1.33e-102	54	563	29	544
QDS73740.1|CBM35|GH27	1.04e-59	53	563	40	588

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F4C_B	2.53e-46	51	414	6	355	Nicotiana benthamiana alpha-galactosidase [Nicotiana benthamiana]
1UAS_A	1.62e-42	51	414	6	354	Chain A, alpha-galactosidase [Oryza sativa]
1SZN_A	2.86e-30	51	412	9	403	Chain A, alpha-galactosidase [Trichoderma reesei],1T0O_A Chain A, alpha-galactosidase [Trichoderma reesei]
4OGZ_A	1.23e-24	54	396	100	449	Crystal structure of a putative alpha-galactosidase/melibiase (BF4189) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution [Bacteroides fragilis NCTC 9343],4OGZ_B Crystal structure of a putative alpha-galactosidase/melibiase (BF4189) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution [Bacteroides fragilis NCTC 9343]
4NZJ_A	3.20e-23	54	391	100	446	Crystal structure of a putative alpha-galactosidase (BF1418) from Bacteroides fragilis NCTC 9343 at 1.57 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CVX4|AGALD_ASPTN	8.47e-53	54	425	34	403	Probable alpha-galactosidase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=aglD PE=3 SV=2
sp|A2R2S6|AGALD_ASPNC	6.77e-49	54	422	32	404	Probable alpha-galactosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=aglD PE=3 SV=2
sp|B0YEK2|AGALD_ASPFC	3.89e-48	54	437	31	418	Probable alpha-galactosidase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=aglD PE=3 SV=2
sp|A4DA70|AGALD_ASPFU	3.89e-48	54	437	31	418	Probable alpha-galactosidase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=aglD PE=3 SV=2
sp|B8N7Z0|AGALD_ASPFN	1.50e-47	54	422	32	402	Probable alpha-galactosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=aglD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.969256	0.030767

TMHMM  Annotations     

There is no transmembrane helices in PTTG_11895-t43_1-p1.