CAZyme Information: PTTG_09892-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_09892-t43_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540		61299.89	8.7037

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000077.1:45442-47324(+)

Full Sequence      

MPLLTRLLKPLWTLYLLSAILYTTSVVVLFPGFRLLFQGIFNSHQSAGDPTFSALQTSTI
QIVPRLLPNHHIDLHSLYHLKIRKNLKGTSVNTDEVIAEDDASLWTAKTGKVSLRVSSPT
SFRRTADGRPIPPRSTLKGFDPSLSDKVDWHPVGHNLSGQAASRDHLLQSARKETHSTTE
DFFLSKAFSDSLGPSKIIPFFYKAIGPDQSGVIDPKDISITTLVTSNRFKVFAKLVENYQ
GPISATIHVSDSPGILQPLLDSLDELYHSSKSMSTWVDIHLVVDSFDRQFNMWRNVAKFF
ARTDYVMMLDVDFWICTDFRRRILDSPELMDQLAAGTSAFVIPAFEYTKQSDGVDPDGFP
SDKQALMKLVSSGQIGMFHKSWMPGHGSTNYTRFYIADQLDQIYPASGYSHSYEPYVVYK
KDKTPYCDERFIGYGANKAACIFELYLSGVSFYVLPQDFLIHQSHAYAEKTRHHERRFNR
KLYSDFREEVCFRYFNEFLKLGVVHEKGQNMLGECKRIRGFAEAAARLGQANLVSINFKK

Enzyme Prediction     

No EC number prediction in PTTG_09892-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	212	496	3.3e-42	0.8338278931750742

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	1.65e-55	217	494	1	326	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR39118.1|GT49	9.10e-166	6	527	18	548
CCA70499.1|GT49	2.04e-132	176	538	79	441
CDS09884.1|GT49	8.77e-132	180	524	53	389
CDS14203.1|GT49	1.03e-131	133	528	45	427
CDS06289.1|GT49	4.24e-130	179	528	83	424

PDB Hits     

PTTG_09892-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5XPT3|LARG2_MOUSE	3.13e-22	207	466	392	639	Xylosyl- and glucuronyltransferase LARGE2 OS=Mus musculus OX=10090 GN=Large2 PE=1 SV=1
sp|Q6P7A1|LARG2_RAT	3.13e-22	215	466	399	639	Xylosyl- and glucuronyltransferase LARGE2 OS=Rattus norvegicus OX=10116 GN=Large2 PE=2 SV=1
sp|Q54PG8|GNT14_DICDI	8.72e-21	218	465	348	584	Glycosyltransferase-like protein gnt14 OS=Dictyostelium discoideum OX=44689 GN=gnt14 PE=2 SV=1
sp|Q9Z1M7|LARG1_MOUSE	4.35e-20	214	466	470	709	Xylosyl- and glucuronyltransferase LARGE1 OS=Mus musculus OX=10090 GN=Large1 PE=1 SV=1
sp|Q21389|LGE1_CAEEL	6.28e-20	215	465	350	592	Glycosyltransferase-like protein LARGE OS=Caenorhabditis elegans OX=6239 GN=lge-1 PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000012	0.000001

TMHMM  Annotations     

Start	End
11	33