CAZyme Information: PTTG_09859-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_09859-t43_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
728	ADAS02000278.1|CGC1	79849.14	7.0327

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000278.1:4986-7461(-)

Full Sequence      

MADPDDRVVHRLGTADYEQPPHQTTHHVRSDSNSDLPHPNPAEETSSLLNPTVDSYQHRP
ANNTTTTSFLRYPPACSDYINPEHPHPPACSSPPQSIDRNYQLDSDHQPPNQHHQLPPSS
LQSNPYQDVILDRPEHQTLLYPFPSTANPSASPPRHPLSFVSTTPSSRPSYHSRTNNSLD
NLLTHSSTPSYSYSYNNNNPGAPPHTRPHRLLPLLPTHSSPTQSPLSSPTIIETPNMPPH
FHHDNPSRHPDNLSPFNILSQYSPPLPPPQQPPHAPYLFPQPNSLLNSVDEFKGTSTQEF
KYPEQTAKNAGYPKEFKSPTDPAHQKARAGKSSDLRRAYHRKFLMIGYRRLAIITIVGLL
LILAAVAVIIYTHINRAHNSDVTGDSDGDVVGQSGLGSARNASSSTGIDPFNATHSAFGP
DNGLRGGINGYDSLVVFGASYCDNAHARPANLRHSLKPSPYYKGRWTNGFVWNEYLSAII
GPGGRPTTLVNYAFGGATVDNGLNEAPVPDLEQQVNAFLSDLSAQSAGAGPSNGKSLIAI
WVGINSITKIWNSVLKSEVQAHSQIDVQDITTRAQLTINSTVDHIFEVVTNLIHTTAFKA
AVPDLLLLPIPPAQLLLVNLRAAKGNLGALRTLAALNDLFNARFADKLVSFQDSLAAEQR
VFTLDIPTIWHKFIEDPASAKLTVVDQPCLTKSGVCSSPDSYLFWDTLHPTTHIHEQLAL
MMAREIKR

Enzyme Prediction     

No EC number prediction in PTTG_09859-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	434	720	3.9e-26	0.9850187265917603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	7.56e-38	433	724	1	269	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
225780	COG3240	1.02e-12	431	723	29	330	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	4.17e-11	431	719	1	274	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
238875	SGNH_plant_lipase_like	4.05e-10	436	711	5	300	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
185279	PRK15381	4.57e-06	434	498	145	207	type III secretion system effector.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
URD49815.1|CE0	1.99e-22	431	727	33	291
BDA67938.1|CE16	1.35e-20	432	719	34	277
UNU22132.1|CE0	8.24e-17	432	719	15	257
UNU27358.1|CE0	1.50e-16	432	719	15	257
UFP94834.1|CE0	5.43e-15	432	719	69	331

PDB Hits     

PTTG_09859-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

PTTG_09859-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000009

TMHMM  Annotations     

Start	End
351	373