CAZyme Information: PTTG_09087-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_09087-t43_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
827		93694.18	4.7602

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000011.1:131823-135317(+)

Full Sequence      

MRLPIPAQPGPLAVIASLLSAAAAEPEPTFHALQRATNQSLLWGTYRPNLYFGLRPRQPH
SLMTGMVWFGTQDFQSFGRARHSCEQSDELMGYGFDKHDGRNFASHYLKDQLNNVELRVQ
MLKVPGGQHGGSWALRINGKKLDEARPSKISLINYFGLDGLGSFQIENEEDEEGIDGEVK
ISGSTTQLGDFTIRIKDSPTNKPAAALRHAEDFGERLSRTQFLGVQVPAGSVWKAKDSII
SAINEYVQPLIEKYTVQDMPDPCLALSLPNEINYGSNLYALQRMYESPFELDIYFDGDGA
PRIDSAALSAGLLAASTAFDQRFKATFPKIASEYSAEEQAMAMEMLSSMIGGIGYFYGSS
IVDRNFAHDYDDDGLLLTGNSEDDEGGSDRKRQPQLTEDRELFTATPSRSFFPRGFYWDE
GFHLALIGAWDNDLSLEILQSWINLIDRDGWVGREQILGEEARSKVPQEFQVQYSNHANP
PTLTMAVTSYLKRLMRYQGADGLKDTLTDADLGMGTGQQIFETAARDGGRISDKLLEDVG
LARSFLGSIYPKLKLHYEWFRETQVGQIREWGRESRSKTEGYRWRGRTAEHVLTSGIDDY
PRGLPHVGELHLDLLCWVGFFTRTMKSIAEFIGETDDVLEYEKNYEAIVDNIDDLHWNEE
KKMHCDVSVDAEDESYFVCHKGYISIFPFLLGLVPHDSPKLKYILDDIRDPTGIWSEFGL
RSLSKSDEFFGKNENYWRGPIWIPMNYMALNSLYTIYAKQSGPHQTQAAELYEELKTNVV
KNVFKEWKRTGFTWEQYDPITGEGRRSKPFTGWTSLVAMIMAEEYDM

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	611	823	2.3e-30	0.43157894736842106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	317	823	15	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	6.58e-96	41	260	1	220	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	1.92e-06	628	773	433	563	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
215307	PLN02567	9.69e-06	619	825	332	544	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR44291.1|GH63	7.07e-318	36	825	35	807
CCA74001.1|GH63	9.56e-297	38	825	35	801
VWO98679.1|GH63	3.08e-290	28	825	12	771
QRW14633.1|GH63	2.21e-283	67	825	1	744
QRV86063.1|GH63	2.21e-283	67	825	1	744

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	3.29e-173	34	821	8	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	1.12e-139	36	825	32	779	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	4.86e-208	33	825	34	808	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	8.20e-173	30	821	34	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	5.52e-140	36	825	87	834	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	1.13e-134	36	825	87	834	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	1.71e-134	36	825	89	837	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.861481	0.138515

TMHMM  Annotations     

There is no transmembrane helices in PTTG_09087-t43_1-p1.