CAZyme Information: PTTG_08520-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_08520-t43_1-p1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
484		55272.23	8.0016

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000007.1:816151-818234(+)

Full Sequence      

MSPQNSPPRSNPISWISDLQDRPLLPLRFNPLQTKGRSTLGSRLATLCALGVLIGTVVVI
DRQLFRNLNEPHLLWDTNLHLTNAVVSRLCNIIPSARNASLPGLLSAKLCSKQLAQKTML
QKVYQPDNGHDFGTAMDRLMDQERCLALFPNLYQELDRAVAYHSSRGNVTIQHLDRAYQY
SHARVLIYRNRVYIKGFNGGPGLRTEAILNSIQEAVITSPELLPDIEFVVKTSDAPQHGD
DEHPLWVLDRTQSQEEVWLMPDYGFYSWPEPKVGGMVEVRDKTAEREATLTWDKKISKAF
WRGAILVKLREQLLEVSKGKSWSDIQPIVWQNLNGGLKTPEDHCNYKFLVHTEGYAYSGR
LKYLQMCRSVVVGHEMQYIQHFHHLLDARPHSPTQNIALAKGPGFEHLPELIDGLLADPT
WAESIANNSYPLFRHYLSPAGVHCYWRQMFRAWAKVQMFVPERSPKDTPFESFNLMHAVD
WPAH

Enzyme Prediction     

No EC number prediction in PTTG_08520-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	223	457	7.1e-23	0.984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	4.78e-26	169	465	25	331	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	2.56e-19	223	459	2	255	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB76195.2|GT0	3.07e-92	135	484	55	427
QLI69899.1|GT0	1.54e-66	140	483	94	456
QSZ37094.1|GT0	8.72e-62	140	481	79	432
QMW35140.1|GT0	1.07e-60	141	476	97	445
QRD91520.1|GT0	1.07e-60	141	476	97	445

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	4.50e-18	156	467	68	387	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8T045|RUMI_DROME	2.47e-17	156	467	80	399	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|Q29AU6|RUMI_DROPS	2.59e-15	189	467	104	397	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1
sp|A0NDG6|RUMI_ANOGA	7.78e-15	98	463	19	392	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	7.98e-15	223	463	137	395	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	1.06e-14	166	463	87	394	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000006	0.000033

TMHMM  Annotations     

There is no transmembrane helices in PTTG_08520-t43_1-p1.