CAZyme Information: PTTG_08487-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_08487-t43_1-p1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
565	ADAS02000027.1|CGC1	62739.81	9.4975

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000027.1:123372-125601(-)

Full Sequence      

MLSFVDLLAWISLAWYAIMVLMAISGSIIAFRKYRQPPPPPPFPISSSPLSQITPNSNPI
RPNSKTQNLLIPSVSILRPLCGLDYGLRENLESGFLQQWPLDRFEIIFCVAHPDDPARKV
AQELISKYPAVRARLLIGEERVGVNPKINNLMEAYRTAEADLLWILDSNVRVHPTTLARA
VSVLCPPSGPTRSRGRTRIGLVHHVPAAVLPQPRGRQKSQRGLGCLLEGCFLNGNHARQY
LSLNALGVASCLMGKSNLFYRSDLEQATRRFLARNRGEHRPNNPSSSGRDESDEQASLLG
SSSNSSNRNQHSSFDALELFGQYLAEDNMIGQTLWDDGIRHAMTIDIVGNVVGPLSIKDY
FSRRIRWIRARKYMSIGCTLVEPFTESILLGIVMTLAVERLGLANGMSKKVVMMIHEVVY
FMLDYCVYRSLLHSPLLSSTPQGSSSAGAIYTRQPTKPSTSTGSSSTLIPSSSSSTSSSA
AHPHPYSQQQGESEHQQEQQQHDSDGGEELIQIKLNFFEFLIGWTLRECSALSIWLVAMS
SNKVQWRKSGKVLKVLRNARVAESN

Enzyme Prediction     

EC	2.4.1.80:3	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT21	72	371	1.2e-79	0.9957081545064378

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133012	Glucosylceramide_synthase	1.81e-65	72	371	1	196	Glucosylceramide synthase catalyzes the first glycosylation step of glycosphingolipid synthesis. UDP-glucose:N-acylsphingosine D-glucosyltransferase (glucosylceramide synthase or ceramide glucosyltransferase) catalyzes the first glycosylation step of glycosphingolipid synthesis. Its product, glucosylceramide, serves as the core of more than 300 glycosphingolipids (GSL). GSLs are a group of membrane components that have the lipid portion embedded in the outer plasma membrane leaflet and the sugar chains extended to the outer environment. Several lines of evidence suggest the importance of GSLs in various cellular processes such as differentiation, adhesion, proliferation, and cell-cell recognition. In pathogenic fungus Cryptococcus neoformans, glucosylceramide serves as an antigen that elicits an antibody response in patients and it is essential for fungal growth in host extracellular environment.
404400	Glyco_transf_21	1.02e-25	129	369	1	174	Glycosyl transferase family 21. This is a family of ceramide beta-glucosyltransferases - EC:2.4.1.80.
404520	Glyco_tranf_2_3	1.33e-11	103	370	31	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
224136	BcsA	2.36e-08	53	369	35	282	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
132997	Glyco_tranf_GTA_type	9.52e-05	87	184	12	102	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV86216.1|GT21	1.01e-83	6	436	19	395
QRW14784.1|GT21	1.01e-83	6	436	19	395
CDR43017.1|GT21	1.50e-82	72	561	51	430
QRW00262.1|GT21	1.54e-82	6	436	19	395
QRW27292.1|GT21	5.26e-79	48	431	37	374

PDB Hits     

PTTG_08487-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J9W453|CEGT_CRYNH	6.83e-65	72	556	55	438	Ceramide glucosyltransferase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=GCS1 PE=1 SV=1
sp|C4R4B3|CEGT_KOMPG	4.45e-55	6	547	41	494	Ceramide glucosyltransferase OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=PAS_chr3_0357 PE=1 SV=1
sp|Q5AMQ4|CEGT_CANAL	4.63e-55	13	436	18	476	Ceramide glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HSX11 PE=1 SV=1
sp|Q9R0E0|CEGT_RAT	6.06e-43	71	429	50	335	Ceramide glucosyltransferase OS=Rattus norvegicus OX=10116 GN=Ugcg PE=1 SV=1
sp|Q5U4S8|CEGTB_XENLA	8.37e-43	71	436	50	342	Ceramide glucosyltransferase-B OS=Xenopus laevis OX=8355 GN=ugcg-b PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

Start	End
7	29