CAZyme Information: PTTG_08354-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_08354-t43_1-p1
• CAZy Family: GH71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
613	ADAS02000107.1|CGC1	70685.51	7.3934

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000107.1:162544-165468(-)

Full Sequence      

MYHTPTRRRGCLVIATLGLPIFILTIYLTHRQPTPSSYTHFPVKPSRLNWPSPLRLLKSN
PSSDAELIQVNHSEDGHLYFDDKVHRSTNGTSQPVLHPIVSLINNATRAWTLKLESQSKH
FSTAVSEYRRRNHRNPPKGYDRWWAWASDNNVKLLDEYDYLHKSIKPFFALPPEVFRQRA
SALVSGQTKWSIMIFVVSIRNGQLSLSGQQANIGLRPNEMIELLKGIAHLLPDMDIPISA
EDLPAVSVSARNYEHHIQAVRNSTLSGPQEMEVIEDQPGLYGWSNTCSSQSELRRHLDGL
QDLSRSSNPHLGQSYIHDPVAASNFCDHPDLVQLNGFLSATQPKVHPFFPLFSFTKLNGF
AELPLSPPSQFRQEVGNDPPWEEKKNKLFWRGSTTGTYFSRINNWRRSQRTRLVMFSNEP
RGNVSVRTTDSKDHLEYFEADTRVLNERYFDIGFTNSPVQCDNSDQSCEAVRNAYVFKPY
AEPSTTNTFKYLLDVDGNGWSGRFHRLMSTKSAILKSTIFPEWYADRIQPWHHYIPVKVD
YQDLYDIMGFFLGDSNGLNAHDQIGKQIGQQGHEWTEEFWRLTDMQAYMYLLLLEYSRLL
NRDPENLHSMDYF

Enzyme Prediction     

No EC number prediction in PTTG_08354-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	342	600	2e-66	0.92

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	2.30e-20	327	589	13	242	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.48e-13	349	593	123	316	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR40913.1|GT90	7.11e-123	76	612	211	752
CDR40837.1|GT90	1.83e-122	87	612	565	1096
CDR40950.1|GT90	1.71e-120	94	612	166	702
CDR40393.1|GT90	9.85e-116	97	611	114	643
CDR48932.1|GT90	5.20e-112	94	612	168	694

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	1.32e-08	489	601	237	343	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	3.38e-86	80	612	132	667	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q6UW63|PLGT2_HUMAN	1.44e-08	374	605	291	472	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	4.44e-08	489	601	265	371	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	7.81e-08	489	601	265	371	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	1.04e-07	489	601	265	371	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999402	0.000628

TMHMM  Annotations     

Start	End
12	29