CAZyme Information: PTTG_08111-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_08111-t43_1-p1
• CAZy Family: GH7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414		46408.12	9.2006

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000099.1:32511-34466(-)

Full Sequence      

MIDSFKKLISFLLNRVNTVNGIRYGDDDTILAVETGNELNWGDSKKIIFQRAPPAKWTLE
IAKHIKSLAPRTLVMDGSYSRKNSSFWEKAVLESEYVDLFDYHLYGENDLNSYAALHDEV
RAYGKTLIIGEHGFYSNIATYNEVYKNFDCAGALIWSLRGHSEKSGFDTHGEGNNIYSYH
APGWQNQTSKAFDTQESSVISATYNASYAILGLNPPPKPVPGTPHPFFLTNGTHAGLSWR
GATWADRYEIFGGHLQGLSFNVLSSQVQDNVGSGEVFVPLDPHQPTKLLTVRPGRPKPHE
SHRGWVDMKWCVPGSVCWKATHLFDKPKNNTTAADFPPISSKQSKFHINPLSQPSTNPRY
QLLPSMLPSSSSTRKRALEGGWYSVRGVNSDGVPGKRSRAVFLKSNWFNWHPKE

Enzyme Prediction     

EC	3.2.1.78:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	2	166	3.2e-31	0.59375

CDD Domains     

PTTG_08111-t43_1-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL40758.1|GH5	1.30e-66	73	401	1	319
ALL41339.1|GH5	4.92e-65	3	228	91	341
CDR43041.1|GH5	7.17e-59	1	280	200	479
CDF80801.1|GH5_41	2.50e-30	1	250	125	364
ABR27262.1|GH5_41	5.83e-27	3	250	162	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PZ9_A	1.36e-09	3	171	153	355	Native structure of endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZG_A I222 crystal form of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZI_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with beta-D-glucose [Thermotoga petrophila RKU-1],3PZM_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with three glycerol molecules [Thermotoga petrophila RKU-1],3PZN_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with citrate and glycerol [Thermotoga petrophila RKU-1],3PZO_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with three maltose molecules [Thermotoga petrophila RKU-1],3PZQ_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with maltose and glycerol [Thermotoga petrophila RKU-1]
6TN6_A	2.08e-09	3	171	139	341	X-ray structure of the endo-beta-1,4-mannanase from Thermotoga petrophila [Thermotoga petrophila RKU-1]
4QP0_A	3.91e-09	1	107	138	260	Crystal Structure Analysis of the Endo-1,4-beta-mannanase from Rhizomucor miehei [Rhizomucor miehei]

Swiss-Prot Hits     

PTTG_08111-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PTTG_08111-t43_1-p1.