CAZyme Information: PTTG_07141-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_07141-t43_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
686		74544.15	7.3667

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000084.1:344687-347202(+)

Full Sequence      

MRIVRLISSGLMIYGSGYLGGSQANQSSSTGTPDRRAPKSQHNTLKSFVTRSVDLTQEYP
HRTCMKPADVMEDVNGHQRRDLPAFSYPFTFSDVVSPRARLGQLIVNPLPYTEPPPKVHP
LSPQKPTNRLSELLPQSLPQSLPQLLPQSVLPLPALSIQTPALLLPPPSAVRGPITASYF
PDWSLDILTPEHIQYHKFDIIYFAFGIPNENYGVDFTQSDSKQTLDKLVGYAHGNGTRVV
LSVGGWGGSKFFSVAVKSDSTRQVFANNLYQLVLTHNLDGIDIDWEYPGQAQIQDNIVSS
EDSAALLSFFQLLRAKLGPHKIISAAVTDYTFLNAQGGRMTNVEEFGKVLDYILIMNYDV
WGATANPGPNAPFSNGCEDSSQPGANMVSSIKTWTSAGFPRQKILMGLAAYGYINHASVT
TLVHRKRSEIPQMSRRFDHYLAQVNRQLNKRQNPCWDPSGVTCLTPNVSAAPPSLTAPIT
NLPPQSVVQTPSTNTIPPSVVQVPAVSVNQTLPPSVDQTFLSGTNQTSSMSINLTQTLDP
NATTTLHATTTTNPVLMDVGSNDPAGLLRTASSGIGSGNLDGHSGSQIQFTDLFKWGIVQ
QNLADSEGRLNGINDYQVAWDRCSSTPYAFSKSRNIVITYDDPISIGIKASYALAAGIGG
VGFWDMTGDHNSMLIDSARKNLARIG

Enzyme Prediction     

No EC number prediction in PTTG_07141-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	177	418	3.2e-42	0.6722972972972973

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	1.09e-45	177	413	3	238	Glyco_18 domain.
395573	Glyco_hydro_18	2.74e-41	176	413	2	225	Glycosyl hydrolases family 18.
119365	GH18_chitinase	2.07e-38	179	412	4	263	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119357	GH18_zymocin_alpha	4.77e-35	179	412	5	242	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
225862	ChiA	8.59e-32	179	683	43	437	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR49082.1|GH18	6.64e-91	172	669	296	762
QRV87962.1|GH18	1.07e-81	160	682	100	504
QRV73087.1|GH18	2.21e-80	165	682	105	504
QRW02133.1|GH18	3.99e-79	165	682	139	538
AAW45591.1|GH18	2.86e-74	167	426	437	696

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	8.23e-29	173	415	1	239	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
6TSB_AAA	3.67e-18	238	444	92	295	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	4.46e-18	238	444	111	314	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]
6G9C_A	1.27e-17	171	412	34	276	Crystal structure of immunomodulatory active chitinase from Trichuris suis, TsES1 [Trichuris suis],6G9C_B Crystal structure of immunomodulatory active chitinase from Trichuris suis, TsES1 [Trichuris suis],6G9E_A Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_B Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_C Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_D Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_E Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_F Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis]
6JM7_A	8.81e-16	238	412	77	251	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P09805|KTXA_KLULA	3.33e-18	188	412	398	613	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|P32470|CHI1_APHAL	1.33e-15	238	412	123	294	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|P11220|CHIT_STRPL	1.56e-15	238	412	334	508	Chitinase 63 OS=Streptomyces plicatus OX=1922 GN=chtA PE=1 SV=2
sp|P36909|CHIT_STRLI	1.58e-15	238	412	333	507	Chitinase C OS=Streptomyces lividans OX=1916 GN=chiC PE=2 SV=1
sp|A0A1B1J8Z2|CHIT5_LOTJA	1.97e-15	167	412	49	289	Class V chitinase CHIT5 OS=Lotus japonicus OX=34305 GN=CHIT5 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.323271	0.676720	CS pos: 30-31. Pr: 0.3646

TMHMM  Annotations     

There is no transmembrane helices in PTTG_07141-t43_1-p1.