CAZyme Information: PTTG_06684-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_06684-t43_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
615		70164.17	6.9959

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000011.1:340483-342793(+)

Full Sequence      

MPPGGWATAIHELAPLAKTIQQQQQKPQIRASHQPSRPRLSALRLSQPHLDAQALQRPIP
DPPAHPQRIPRLVRQAPAAEPDPPTRRRRIQETLPSPAPTGFKEWFTWAKENQVKLVDEF
DRVNELIEPFWALPPHVLRNRTEEAGKNEAFSTFVVKDGKVKAIGAKKDAPRTIDQLKLL
EVIVPHLPDVNVTMSHHDGPSVFMDWKTKQRHLDHARAGTVLPAELIDRVEDDASLWGFV
GACAPDSPMRMVANGLAEELKVQHAGPGGYIGLDHAKTMDLCAHPEWQEFHGFTAWAGPR
PLPLRPIFSFAQSPGFVSDILNAPLEQFEDSTKNAQQVKSWEEKEEDGRLLWRGQTTGVW
FDRQTNWRKSHRVRLHRLGVAPAHSYGHSLKRRLRSPAVVLHSNASTEDVEVDDDSRDAP
VVVLENEYSLAQLSKRYLSASFVGDLVQCTVEDSSCEAISKEIEFGAPVDWQFQNNFKYV
LDVDGNSWSGRFRRLLKSNAVVFKSTIWPEWYRDHIQPWHHYVPVRIDYEDVFDLMSFFA
GPPDPDHPLSPHPFVDGGKVRTKGFDRVAKLIADQGSQWADEHFRYQDIRAYVWRTYLEW
ARVSSDDRAQMNFHF

Enzyme Prediction     

No EC number prediction in PTTG_06684-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	303	603	2.6e-53	0.896

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.05e-10	467	592	136	241	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	4.64e-08	474	602	213	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR40913.1|GT90	6.28e-136	99	613	282	752
CDR40950.1|GT90	3.69e-92	99	615	209	704
CDR48932.1|GT90	6.05e-91	87	613	203	694
AAN75613.2|GT90	7.57e-87	97	613	154	634
CDR40393.1|GT90	1.67e-86	99	607	154	635

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	1.33e-08	477	605	237	343	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	1.87e-06	469	599	264	373	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	3.57e-72	99	608	192	660	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	7.85e-08	477	605	265	371	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	7.85e-08	477	605	265	371	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1
sp|Q8NBL1|PGLT1_HUMAN	7.85e-08	477	605	265	371	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q16QY8|RUMI_AEDAE	1.42e-07	477	598	281	381	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PTTG_06684-t43_1-p1.