CAZyme Information: PTTG_06474-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_06474-t43_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410		44875.89	8.9558

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000076.1:21792-23780(-)

Full Sequence      

MRSFSQVFSATFLLAALFFASTDAYAYDSRTASRPQVKGYYPSYNSDGQPVSKIDWTAYT
DVLYFMVIPQPDFTLSYDPKLTKAQGDKLVTEFVAAARKYKVNPLFSTGGWTGSRHFSNL
TSTDAARKRFAQLLVQFGKKHGFVGIEMDWEYPNGALDVTLENPADVVNFGLLVKEIRAL
WPQASLTAAFGIGGLIGRAGTPATAMETALLVQNLNYINLMAYDVYGAWAPTTGPLAPIR
ATCAPAAFGQSVETGVQIALKQGFKASQVILGIPGYAKRLELVSPKLVVQNVKGHLTEYY
QNHTSVTPPGGQFDDKPGKDICGNAQKWGGSFLVNELVSNGWLTKDQKHGAGGYTRYYDL
CSGQPFLTNGKYFITYDDQFSTVDKAKFAKQNALGGIYFFDTQGPAPETR

Enzyme Prediction     

No EC number prediction in PTTG_06474-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	36	402	2.5e-44	0.9222972972972973

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	1.27e-54	39	401	4	330	Glyco_18 domain.
395573	Glyco_hydro_18	8.73e-51	39	401	4	303	Glycosyl hydrolases family 18.
119365	GH18_chitinase	1.83e-49	39	399	3	316	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
225862	ChiA	5.71e-45	35	404	38	422	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119351	GH18_chitolectin_chitotriosidase	8.27e-40	101	397	66	333	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAP42832.1|GH18	1.63e-301	1	409	1	410
CDR43393.1|GH18	4.17e-71	31	404	20	392
CRX79101.1|GH18	2.05e-64	64	398	6	336
ALL41259.1|GH18	1.46e-61	221	409	1	190
AYA60264.1|GH18	2.40e-51	38	404	29	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ITX_A	8.77e-33	45	409	56	410	Chain A, Glycosyl Hydrolase [Niallia circulans]
5GZU_A	5.14e-30	36	401	27	373	Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZT_B	5.77e-30	36	401	278	624	Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
6LE8_A	1.14e-26	60	398	32	341	Chain A, Probable endochitinase [Caenorhabditis elegans]
6LE7_A	1.58e-26	60	398	31	340	Chain A, Probable endochitinase [Caenorhabditis elegans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	4.25e-31	45	409	88	442	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|Q11174|CHIT_CAEEL	4.60e-25	60	398	83	392	Probable endochitinase OS=Caenorhabditis elegans OX=6239 GN=cht-1 PE=1 SV=1
sp|P11797|CHIB_SERMA	1.67e-24	76	400	61	403	Chitinase B OS=Serratia marcescens OX=615 GN=chiB PE=1 SV=1
sp|Q13231|CHIT1_HUMAN	1.12e-23	101	396	89	354	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|Q9WTV1|CH3L1_RAT	4.23e-23	98	396	84	346	Chitinase-3-like protein 1 OS=Rattus norvegicus OX=10116 GN=Chi3l1 PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000347	0.999609	CS pos: 24-25. Pr: 0.9802

TMHMM  Annotations     

There is no transmembrane helices in PTTG_06474-t43_1-p1.