CAZyme Information: PTTG_06368-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_06368-t43_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
597	ADAS02000028.1|CGC1	64496.13	7.4745

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000028.1:908963-911198(+)

Full Sequence      

MHKRHPSSSSIPTSTSRTSISPSRATLLSSPRSPIHSRASSLLSRRRLLVVLAILSTVFI
LIHFISWSGSPMGPLPGFATRSAGSRRTDAYLISARRQRLLQGASTSSAGLGPANFSDLA
PFTFCPTFGETDELGQVYGSQALLKTRTHVGSSDRIRRVIRRAMAGLPITIGILGGSISS
CHGLDATAAHPLGNPIGPNCYPHRIFTWLNDVFPHPANELTNGALRRTGTAYYGFCSAMH
LPDRVDLVIVEFDTEDPHEPETISTTDLLIRSLLLRPDQPAVILLGHFAPQFQNEHGFTG
PEVWHSAVAHFYDVPHLTVKGLLYEEYLANPEKVSQSYFIDPVLANAKGHELLADTVISF
LESEICVVWDEAALEADLAGLSPPVLGDASLMSGSQANTAPSLLGGKGLRKGSEPGAEGS
DESSGTLGLSKTAKAGYSKVPAYRIHDKPHTLAGFREIKPSCASANDLINPLPQSVFINS
GWSPVAPKLDAEDERHYWFSERPGSLIKIPLKVSGGDIAVYYQKGPKKDGWGTVKCWVDD
NVAGAVEIHGFWDQDHAKPVISQVDRGVGKGSHYVVCELQGKPTDQAKFKIYGIFSS

Enzyme Prediction     

No EC number prediction in PTTG_06368-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE17	197	350	1.1e-16	0.9030303030303031

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238141	SGNH_hydrolase	5.04e-07	171	360	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV84988.1|GT90	3.42e-143	114	597	694	1144
QRV99024.1|GT90	3.42e-143	114	597	694	1144
QRW26062.1|GT90	3.60e-116	114	597	334	753
UQK44885.1|CE17	1.31e-17	155	363	8	202
UQK50927.1|CE17	1.33e-17	155	363	8	202

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HH9_A	3.57e-12	151	362	15	211	Crystal structure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82],6HH9_B Crystal structure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82],6HH9_C Crystal structure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82],6HH9_D Crystal structure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82]

Swiss-Prot Hits     

PTTG_06368-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999972	0.000054

TMHMM  Annotations     

Start	End
48	67