CAZyme Information: PTTG_06204-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_06204-t43_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
539		58302.39	9.6207

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000108.1:274333-277512(+)

Full Sequence      

MPRRHGMSEILLPPMTGECSMVSARIDNRARDPIDPLPTVAIGRWIVVCLMIPRAGKAPR
LTPSLTHVDLKFEFELVGEIAIPGLSTDGESWGLSDAGLIVGRAAISLAGPDQNPAFRGA
TEIREKHPLLHPDAAAAGEMVHQPTSRTEAAQAALGPSERRSSRLLSANADPSVHIHRRS
PEKPSKPSGIRGQKLYSPGMKPSSIEGASSNLPDPKITAKATPFGFGSKVTGGGKAQPQT
PKNAAELEAWLTDKVPRVIRIDKIYDFTSPTNTTIKGWVNQILAASDDWCSKEKNLPGNV
PVSAQVSPLNPIKIQGQKTLVGFTCFNEPSVHKPLKLIQLIHQLSSLECPHYLAQSIRCR
QMIAGGGMHQVEANTGITISNNLFSGKTKWSQRCNNRHYWTILISGADDEVTMARKLSSS
SRTYIHLNQIIQEENVNRGRAPKTGGTGNPKVSLHYYNNVHTNILGETFEIGSGSNVLAE
GNIFDNVKIQNPSDIKTQDAGHSQVLDNLKRFPVVAQANILPASSIQREVSGQCGAGHI

Enzyme Prediction     

No EC number prediction in PTTG_06204-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	359	486	9.3e-24	0.5614973262032086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	5.67e-11	375	488	102	190	Amb_all domain.
366158	Pec_lyase_C	6.83e-07	372	484	122	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW21460.1|PL1_4	4.43e-35	219	498	20	303
QRV94198.1|PL1_4	8.38e-32	219	487	20	308
QRW08421.1|PL1_4	3.96e-31	217	487	18	307
QRV79560.1|PL1_4	4.03e-31	217	487	18	308
QMW40699.1|PL1_4	7.04e-31	195	494	3	308

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	1.90e-23	225	489	9	281	Pectin Lyase B [Aspergillus niger]
1IDJ_A	4.62e-20	225	487	9	279	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1IDK_A	4.62e-20	225	487	9	279	Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8N316|PELF_ASPFN	1.25e-31	195	494	3	308	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	1.25e-31	195	494	3	308	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|A1CFS2|PELA_ASPCL	1.88e-26	225	488	27	298	Probable pectin lyase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=pelA PE=3 SV=1
sp|Q0CZD4|PELF2_ASPTN	1.91e-26	223	488	27	300	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q5B3J8|PELF_EMENI	4.42e-25	222	487	25	296	Probable pectin lyase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000024	0.000017

TMHMM  Annotations     

There is no transmembrane helices in PTTG_06204-t43_1-p1.